Project name: Mb5-11_LVLLLI

Status: done

Started: 2026-07-06 06:34:31
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPLSINYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.705
Maximal score value
1.3737
Average score
-0.6874
Total score value
-74.9305

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3876
2 Q A -0.8302
3 A A -0.7101
4 N A -1.2476
5 S A -0.8893
6 G A 0.0000
7 S A -1.0986
8 L A 0.0000
9 E A -1.9493
10 V A 0.0000
11 V A -0.0905
12 E A -1.5580
13 A A -1.2674
14 S A -1.4400
15 P A -1.6911
16 T A -1.1277
17 S A -1.1717
18 L A 0.0000
19 Q A -1.1649
20 L A 0.0000
21 S A -1.1337
22 W A 0.0000
23 D A -1.8553
24 A A -1.2634
25 F A 0.0000
26 H A -1.0786
27 R A -0.2427
28 Y A 0.7831
29 H A -0.0438
30 N A -0.7225
31 G A 0.0261
32 F A 1.3737
33 T A 0.6115
34 H A 0.0016
35 P A -0.3946
36 V A -1.0032
37 R A -1.2522
38 Y A -0.8196
39 Y A 0.0000
40 R A -0.7830
41 V A 0.0000
42 T A 0.0000
43 Y A -0.2912
44 G A 0.0000
45 E A -1.5105
46 T A -1.1914
47 G A -1.2025
48 G A -1.3519
49 N A -1.5347
50 S A -0.9016
51 P A -0.3494
52 V A 0.4147
53 Q A -0.9656
54 E A -1.6607
55 F A -0.5715
56 T A -0.1408
57 V A -0.4133
58 P A -0.9406
59 G A -1.2241
60 S A -1.2808
61 K A -1.8051
62 S A -1.1557
63 T A -0.8956
64 A A 0.0000
65 T A -0.4778
66 L A 0.0000
67 S A -0.8005
68 G A -0.9866
69 L A 0.0000
70 K A -2.3523
71 P A -1.8379
72 G A -1.1011
73 V A -1.0702
74 D A -2.0405
75 Y A 0.0000
76 T A -0.7049
77 L A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2857
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6342
85 Y A 0.0000
86 P A -0.4612
87 R A -1.1257
88 Y A 0.6602
89 G A 0.5828
90 Y A 0.8661
91 G A 0.1928
92 E A -0.7906
93 S A 0.0000
94 G A -0.6590
95 P A -0.4260
96 L A -0.4247
97 S A -0.4240
98 I A -0.4952
99 N A -1.6517
100 Y A -1.5184
101 R A -2.4122
102 T A 0.0000
103 E A -1.8961
104 L A -0.9615
105 D A -2.5481
106 K A -2.7050
107 P A -1.7903
108 S A -1.6386
109 Q A -1.6631
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018