Project name: query_structure

Status: done

Started: 2026-03-17 01:22:27
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYYITYGETGHYWYYQAFAVPGSKSTATISGLSPGVDYTITVYAPFSVPVMSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)
Show buried residues

Minimal score value
-2.6824
Maximal score value
2.9078
Average score
-0.0034
Total score value
-0.3026

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8238
2 S A 0.8294
3 S A 1.5638
4 V A 0.6097
5 P A 0.0000
6 T A -1.6449
7 K A -2.6586
8 L A 0.0000
9 E A -1.9503
10 V A 0.0751
11 V A 1.5242
12 A A 0.8879
13 A A 0.3180
14 T A -0.3902
15 P A -0.8194
16 T A -0.5411
17 S A -0.3292
18 L A 0.0000
19 L A 0.7291
20 I A 0.0000
21 S A -0.9757
22 W A 0.0000
23 D A -2.6824
24 A A -1.2067
25 P A 0.0782
26 A A 0.5284
27 V A 0.9553
28 T A 0.0260
29 V A -0.4966
30 D A -1.8021
31 H A -1.1281
32 Y A 0.0000
33 Y A 0.5963
34 I A 0.0000
35 T A 0.4527
36 Y A 0.0000
37 G A 0.0000
38 E A -0.3930
39 T A -0.6951
40 G A -0.3888
41 H A 0.4633
42 Y A 2.0665
43 W A 2.3929
44 Y A 2.3524
45 Y A 1.9566
46 Q A 0.2901
47 A A 0.4629
48 F A 0.4986
49 A A 0.2238
50 V A 0.0000
51 P A -1.2224
52 G A -1.4573
53 S A -1.4197
54 K A -2.1378
55 S A -1.3724
56 T A -0.7296
57 A A 0.0000
58 T A 0.2332
59 I A 0.0000
60 S A -0.4820
61 G A -0.6928
62 L A 0.0000
63 S A -0.8181
64 P A -0.9794
65 G A -1.0478
66 V A -0.8100
67 D A -1.7303
68 Y A 0.0000
69 T A -0.6687
70 I A 0.0000
71 T A 0.1401
72 V A 0.0000
73 Y A 0.8016
74 A A 0.0000
75 P A 1.2116
76 F A 2.3574
77 S A 2.3717
78 V A 2.8742
79 P A 1.9481
80 V A 2.9078
81 M A 2.4523
82 S A 1.2815
83 P A 0.7321
84 I A 0.2210
85 S A -0.5294
86 I A -0.7785
87 N A -1.7199
88 Y A -1.4044
89 R A -2.2757
90 T A -1.1618
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018