Project name: d632544aa4d0be2

Status: done

Started: 2026-04-15 10:49:30
Settings
Chain sequence(s) A: CPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:10)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:10)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:10)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:10)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:10)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:31)
Show buried residues

Minimal score value
-4.1253
Maximal score value
1.6656
Average score
-0.6808
Total score value
-87.8196

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
14 C A -0.2256
15 P A -1.1100
16 E A -2.0724
17 G A -1.4108
18 T A -0.6601
19 N A -0.3507
20 A A 0.5619
21 Y A 1.6656
24 Y A 0.6638
25 C A 0.0000
26 Y A 0.0000
27 Y A -0.4650
28 F A -0.9271
29 N A -1.7584
30 E A -3.3089
31 D A -3.8030
32 R A -4.1253
33 E A -2.8832
34 T A -1.9698
35 W A 0.0000
36 V A 0.6639
37 D A -0.8169
38 A A 0.0000
39 D A 0.0000
40 L A 0.3572
41 Y A 0.0660
42 C A 0.0000
43 Q A -1.0719
44 N A -0.9965
45 M A 0.0850
46 N A -0.9336
47 S A -1.1706
48 G A 0.0000
49 N A -0.6919
50 L A 0.0000
51 V A 0.0000
52 S A 0.0000
53 V A 0.0000
54 L A 0.1503
55 T A -0.6157
56 Q A -1.4932
57 A A -0.4615
58 E A 0.0000
59 G A -0.8656
60 A A -0.4787
61 F A -0.0626
62 V A 0.0000
63 A A 0.0000
64 S A -1.2568
65 L A -1.0647
66 I A 0.0000
67 K A -3.0223
68 E A -2.8324
69 S A -2.2248
70 G A -2.1108
71 T A -1.9998
72 D A -2.0237
73 D A -0.9528
74 F A 1.2116
75 N A -0.0760
76 V A 0.0000
77 W A 0.0000
78 I A 0.0000
79 G A 0.0000
80 L A 0.0000
81 H A -0.8146
82 D A 0.0000
83 P A -2.0621
84 K A -3.4108
85 K A -3.5498
86 N A -3.3601
87 R A -2.7214
88 R A -3.1276
89 W A -1.5231
90 H A -0.9169
91 W A 0.0000
92 S A -0.3341
93 S A -0.4534
94 G A -0.2753
95 S A 0.4862
96 L A 1.6130
97 V A 0.8891
98 S A 0.2523
99 Y A -0.4489
100 K A -1.6881
101 S A 0.0000
102 W A -0.4706
103 G A 0.0718
104 I A 1.5847
105 G A 0.5502
106 A A 0.0632
107 P A -0.0930
108 S A -0.0287
109 S A -0.0079
110 V A 0.9499
111 N A -0.5118
112 P A -0.7450
113 G A 0.0000
114 Y A -1.2466
115 C A 0.0000
116 V A 0.0000
117 S A 0.0000
118 L A 0.0000
119 T A 0.0000
120 S A -0.3634
121 S A -0.1456
122 T A -0.3175
123 G A -0.7804
124 F A 0.0000
125 Q A -1.6912
126 K A -1.3246
127 W A 0.0000
128 K A -0.6838
129 D A 0.0000
130 V A 0.0000
131 P A -1.2122
132 C A -1.0591
133 E A -2.3561
134 D A -2.3515
135 K A -3.2512
136 F A 0.0000
137 S A 0.0000
138 F A 0.0000
139 V A 0.0000
140 C A 0.0000
141 K A -0.4702
142 F A 0.0000
143 K A -1.8975
144 N A -1.7181
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018