Project name: dccb90f9d5a9dd3cfd868946f1b38e25

Status: done

Started: 2026-03-07 00:23:49
Settings
Chain sequence(s) B: CGSGMKLDLSSLSVEELEELLKSFEKVLEEEEKDLNRYPGSTLEENKKAVEEVKEALEKKKKEL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:49)
Show buried residues

Minimal score value
-4.8145
Maximal score value
0.2428
Average score
-2.5124
Total score value
-160.793

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C B 0.2428
2 G B -0.8006
3 S B -0.4923
4 G B -0.6312
5 M B 0.1373
6 K B -1.0606
7 L B -0.3341
8 D B -1.4040
9 L B -1.2245
10 S B -0.7187
11 S B -0.6721
12 L B -0.9615
13 S B -1.6779
14 V B -2.4225
15 E B -3.4176
16 E B -3.5820
17 L B 0.0000
18 E B -3.9045
19 E B -4.1261
20 L B -2.6125
21 L B -3.2812
22 K B -3.5571
23 S B -2.1283
24 F B -2.1180
25 E B -3.6150
26 K B -3.5378
27 V B -2.2503
28 L B -3.3777
29 E B -4.4272
30 E B -4.0412
31 E B 0.0000
32 E B -4.0886
33 K B -4.0228
34 D B -3.4290
35 L B -1.9004
36 N B -2.4866
37 R B -3.0016
38 Y B -1.8479
39 P B -1.4350
40 G B -1.7076
41 S B -1.6747
42 T B -1.8992
43 L B -2.5136
44 E B -3.6644
45 E B -3.7662
46 N B 0.0000
47 K B -4.0147
48 K B -4.5020
49 A B -3.4466
50 V B 0.0000
51 E B -4.5041
52 E B -4.2382
53 V B 0.0000
54 K B -4.2297
55 E B -4.6088
56 A B -3.7601
57 L B -4.1448
58 E B -4.8145
59 K B -4.4216
60 K B -3.4202
61 K B -3.7322
62 K B -3.8646
63 E B -3.0775
64 L B -0.5794
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018