Project name: C_2

Status: done

Started: 2025-02-27 09:31:41
Settings
Chain sequence(s) A: MGSHHHHHHMQKKNQIAAAIVLRGLAKDGKFANTEAAAKMKKSDKIAAAIVLRGLAKDGKFAAAEAAAKQNKNDQIAAAIVLRGLAKGGKFANAEAAAKKKKNDQIAAALVLRGVAKSGKFAGAEAAAKITRNDEIAAAIVLRGMAKGGRFFASEAAAKMKKDDQIAAAIALRGMAKDGKFAVKGGG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:51)
Show buried residues

Minimal score value
-4.0528
Maximal score value
2.869
Average score
-1.1216
Total score value
-209.7368

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.3314
2 G A -1.3792
3 S A -1.8460
4 H A -1.9783
5 H A -1.4468
6 H A -1.8142
7 H A -1.8116
8 H A -1.9336
9 H A -2.7925
10 M A -2.2813
11 Q A -2.8857
12 K A -3.5127
13 K A -3.5376
14 N A -3.1962
15 Q A -2.9817
16 I A -1.9883
17 A A -1.5333
18 A A -1.0110
19 A A 0.0000
20 I A 0.0000
21 V A 0.3084
22 L A 0.0036
23 R A -1.4794
24 G A 0.0000
25 L A -0.9891
26 A A -1.8680
27 K A -2.8760
28 D A -3.1684
29 G A -2.4370
30 K A -2.4951
31 F A -1.2906
32 A A -0.7271
33 N A -1.1520
34 T A -1.5156
35 E A -2.3084
36 A A 0.0000
37 A A -1.5798
38 A A -1.7150
39 K A -2.3042
40 M A -2.2721
41 K A -3.1847
42 K A -2.9857
43 S A -2.0498
44 D A -2.2717
45 K A -1.3203
46 I A 0.5019
47 A A 0.8196
48 A A 0.0000
49 A A 0.9942
50 I A 2.6989
51 V A 2.8441
52 L A 1.0388
53 R A -0.8375
54 G A 0.2950
55 L A 0.8896
56 A A -1.2843
57 K A -2.8563
58 D A -3.1906
59 G A -2.5018
60 K A -2.2932
61 F A -0.3788
62 A A -0.6595
63 A A -0.5353
64 A A -0.8201
65 E A -1.9484
66 A A -1.6895
67 A A -1.9853
68 A A -2.6308
69 K A -3.9346
70 Q A -4.0134
71 N A -3.9342
72 K A -4.0528
73 N A -3.3299
74 D A -2.9045
75 Q A -1.9268
76 I A -0.4997
77 A A -0.4685
78 A A 0.0000
79 A A 0.0000
80 I A 0.3978
81 V A 0.0000
82 L A 0.0000
83 R A -1.1401
84 G A 0.0000
85 L A 0.0000
86 A A -1.8108
87 K A -2.3644
88 G A -1.7722
89 G A -1.4006
90 K A -1.5269
91 F A -0.4118
92 A A -0.5120
93 N A -1.9287
94 A A 0.0000
95 E A -1.3483
96 A A -1.6617
97 A A 0.0000
98 A A -2.4581
99 K A -3.5823
100 K A -3.3779
101 K A -3.2158
102 K A -3.8687
103 N A -3.4891
104 D A -3.2039
105 Q A -2.4799
106 I A -1.2985
107 A A -0.6402
108 A A 0.0430
109 A A 0.0000
110 L A 1.3783
111 V A 2.8690
112 L A 2.7967
113 R A 0.0000
114 G A 0.0000
115 V A 2.1783
116 A A 1.2855
117 K A 0.0000
118 S A -0.2250
119 G A -0.1944
120 K A 0.1190
121 F A 1.1928
122 A A 0.4997
123 G A 0.3737
124 A A -0.0201
125 E A -0.7175
126 A A 0.0000
127 A A 0.0520
128 A A -1.1181
129 K A -2.1035
130 I A 0.0000
131 T A -1.3231
132 R A -2.7299
133 N A -2.0113
134 D A 0.0000
135 E A -0.1943
136 I A 0.0000
137 A A 0.2578
138 A A 0.0000
139 A A 0.0000
140 I A 1.0577
141 V A 0.3784
142 L A 0.0000
143 R A -0.7961
144 G A -1.1752
145 M A -1.1885
146 A A -1.2753
147 K A -2.4605
148 G A -1.8126
149 G A -1.7640
150 R A -1.7633
151 F A 0.4290
152 F A 0.3061
153 A A 0.0000
154 S A -0.6749
155 E A -0.8814
156 A A 0.0000
157 A A 0.0000
158 A A -1.8037
159 K A -1.9470
160 M A 0.0000
161 K A -3.0163
162 K A -2.8742
163 D A -2.2626
164 D A -1.5357
165 Q A -0.8435
166 I A 0.0000
167 A A 0.0000
168 A A 0.0000
169 A A 0.0000
170 I A 0.0000
171 A A -0.3021
172 L A 0.0000
173 R A 0.0000
174 G A -1.8968
175 M A -1.4234
176 A A -1.6801
177 K A -3.1166
178 D A -3.2447
179 G A -2.8308
180 K A -2.5077
181 F A -0.7115
182 A A -0.3103
183 V A -0.1590
184 K A -2.0611
185 G A -1.3873
186 G A -1.5487
187 G A -1.4345
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018