Project name: d6a7adfeae4d86e

Chain sequence(s)	A: MAQVQLLESGGGLVQPGGSLRLSCAASGFRVSNYDMGWVRQAPGKGLEWVSSIETPSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGLCQIVPGSYPWQPNTLEFWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:52)

• Minimal score value: -2.709
• Maximal score value: 1.6815
• Average score: -0.5656
• Total score value: -72.9648

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.8052
2	A	A	-0.0489
3	Q	A	-0.8929
4	V	A	-0.3959
5	Q	A	-0.5680
6	L	A	0.0000
7	L	A	0.9305
8	E	A	0.2241
9	S	A	-0.3469
10	G	A	-0.8062
11	G	A	0.0682
12	G	A	0.6165
13	L	A	1.3322
14	V	A	0.0000
15	Q	A	-1.3846
16	P	A	-1.5003
17	G	A	-1.3174
18	G	A	-0.9091
19	S	A	-1.2985
20	L	A	-0.9896
21	R	A	-2.2641
22	L	A	0.0000
23	S	A	-0.5463
24	C	A	0.0000
25	A	A	-0.2919
26	A	A	0.0000
27	S	A	-0.7005
28	G	A	-0.7665
29	F	A	-1.1732
30	R	A	-2.5212
31	V	A	0.0000
32	S	A	-1.7797
33	N	A	-1.6979
34	Y	A	-0.6541
35	D	A	0.0000
36	M	A	0.0000
37	G	A	0.0000
38	W	A	0.0000
39	V	A	0.0000
40	R	A	0.0000
41	Q	A	-0.7113
42	A	A	-1.1192
43	P	A	-1.3094
44	G	A	-1.5709
45	K	A	-2.2647
46	G	A	-1.3384
47	L	A	-0.5572
48	E	A	-0.9975
49	W	A	0.0000
50	V	A	0.0000
51	S	A	0.0000
52	S	A	0.0000
53	I	A	0.0000
54	E	A	-0.2843
55	T	A	-0.5425
56	P	A	-0.6056
57	S	A	-0.5362
58	G	A	-0.5340
59	S	A	-0.2911
60	T	A	0.0447
61	Y	A	0.0490
62	Y	A	-0.6882
63	A	A	-1.3229
64	D	A	-2.4548
65	S	A	-1.7065
66	V	A	0.0000
67	K	A	-2.5540
68	G	A	-1.7520
69	R	A	-1.5635
70	F	A	0.0000
71	T	A	-0.8927
72	I	A	0.0000
73	S	A	-0.6275
74	R	A	-1.2807
75	D	A	-2.0156
76	N	A	-2.7090
77	S	A	-2.0720
78	K	A	-2.6913
79	N	A	-2.2261
80	T	A	0.0000
81	L	A	0.0000
82	Y	A	-0.7717
83	L	A	0.0000
84	Q	A	-1.5819
85	M	A	0.0000
86	N	A	-1.3761
87	S	A	-1.1409
88	L	A	0.0000
89	R	A	-2.0693
90	A	A	-1.6264
91	E	A	-2.1934
92	D	A	0.0000
93	T	A	-0.3848
94	A	A	0.0000
95	V	A	0.8130
96	Y	A	0.0000
97	Y	A	0.4270
98	C	A	0.0000
99	A	A	0.0000
100	G	A	0.0000
101	L	A	0.0000
102	C	A	-0.0885
103	Q	A	-0.1898
104	I	A	1.0632
105	V	A	1.5590
106	P	A	0.4125
107	G	A	-0.1015
108	S	A	0.0561
109	Y	A	-0.0099
110	P	A	-0.6504
111	W	A	0.0000
112	Q	A	-1.6681
113	P	A	-1.4168
114	N	A	-1.7817
115	T	A	-1.3874
116	L	A	0.0000
117	E	A	-1.2781
118	F	A	-0.0796
119	W	A	0.0890
120	G	A	-0.0319
121	Q	A	-0.8767
122	G	A	0.0308
123	T	A	0.5420
124	L	A	1.6815
125	V	A	0.0000
126	T	A	0.3470
127	V	A	0.0000
128	S	A	-0.7598
129	S	A	-0.5188