Project name: d6c126e5e5e7ca3

Chain sequence(s)	A: LRLSLCVSVCLQVETAPIVDSWATEIIHRAKRSLLWRWNTLKPVGAGCRDNYECGTNYCR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)

• Minimal score value: -2.5333
• Maximal score value: 2.3505
• Average score: 0.0268
• Total score value: 1.6078

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	L	A	1.3943
3	R	A	-0.3643
4	L	A	1.6690
5	S	A	1.2469
6	L	A	1.2399
7	C	A	1.8287
8	V	A	2.3505
9	S	A	1.5234
10	V	A	1.5489
11	C	A	1.8117
12	L	A	1.6748
13	Q	A	0.3306
14	V	A	0.3917
15	E	A	-0.9807
16	T	A	-0.5850
17	A	A	-0.1271
18	P	A	-0.1137
19	I	A	0.5686
20	V	A	1.1615
21	D	A	-0.7947
22	S	A	-0.2097
23	W	A	0.7364
24	A	A	0.3134
25	T	A	-0.0794
26	E	A	-0.6334
27	I	A	0.0000
28	I	A	0.2658
29	H	A	-1.1871
30	R	A	-1.4796
31	A	A	-0.8993
32	K	A	-2.5333
33	R	A	-2.2243
34	S	A	-0.6816
35	L	A	0.6516
36	L	A	1.4591
37	W	A	0.3961
38	R	A	0.2104
39	W	A	1.1302
40	N	A	-0.2429
41	T	A	-0.0420
42	L	A	0.1030
43	K	A	-0.5871
44	P	A	0.0728
45	V	A	1.0731
46	G	A	-0.0990
47	A	A	-0.3022
48	G	A	-1.1223
49	C	A	-1.3113
50	R	A	-2.4127
51	D	A	-1.6631
52	N	A	-0.8456
53	Y	A	-0.5863
54	E	A	0.0000
55	C	A	0.0000
56	G	A	0.1257
57	T	A	0.2116
58	N	A	0.0382
59	Y	A	0.6680
60	C	A	-0.7598
61	R	A	-1.7206