Project name: d6e5abffaced3c2

Chain sequence(s)	A: RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:47)

• Minimal score value: -2.0178
• Maximal score value: 2.0947
• Average score: -0.3343
• Total score value: -18.7208

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	R	A	-1.8677
2	P	A	-0.8016
3	D	A	-1.7570
4	F	A	-0.0077
5	C	A	0.0000
6	L	A	1.5034
7	E	A	0.0220
8	P	A	-0.3148
9	P	A	-0.0872
10	Y	A	0.3882
11	T	A	0.0050
12	G	A	-0.1256
13	P	A	-0.1246
14	C	A	-0.0113
15	K	A	-1.6358
16	A	A	-0.6277
17	R	A	-1.7183
18	I	A	0.6464
19	I	A	2.0947
20	R	A	0.0035
21	Y	A	0.2507
22	F	A	0.0000
23	Y	A	0.0000
24	N	A	-0.2906
25	A	A	-0.3993
26	K	A	-1.6872
27	A	A	-0.3435
28	G	A	-0.1985
29	L	A	1.3028
30	C	A	0.2145
31	Q	A	-0.6839
32	T	A	-0.1118
33	F	A	0.2643
34	V	A	0.6643
35	Y	A	0.0000
36	G	A	0.0000
37	G	A	-0.3083
38	C	A	-0.2418
39	R	A	-1.8050
40	A	A	-0.4623
41	K	A	-1.2774
42	R	A	-2.0178
43	N	A	0.0000
44	N	A	-0.1283
45	F	A	-0.1296
46	K	A	-1.6693
47	S	A	-0.3393
48	A	A	-0.2952
49	E	A	-1.7251
50	D	A	-0.9105
51	C	A	0.0000
52	M	A	0.4471
53	R	A	-1.6983
54	T	A	-0.3723
55	C	A	0.0000
56	G	A	-0.3531