Project name: Hmed_HV1

Status: done

Started: 2026-04-26 04:15:25
Settings
Chain sequence(s) I: VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
input PDB
Selected Chain(s) I
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with I chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)
Show buried residues

Minimal score value
-3.6857
Maximal score value
2.9497
Average score
-1.246
Total score value
-80.9919

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V I 2.7494
2 V I 2.9497
3 Y I 1.4586
4 T I -0.1060
5 D I -2.1628
6 C I 0.0000
7 T I -1.4033
8 E I -2.1006
9 S I -0.9815
10 G I -1.0044
11 Q I 0.0000
12 N I 0.0000
13 L I -0.3793
14 C I 0.0000
15 L I -0.7880
16 C I 0.0000
17 E I -2.4015
18 G I -2.0298
19 S I -1.3945
20 N I -1.6397
21 V I -0.2967
22 C I 0.0000
23 G I -0.9772
24 Q I -1.8922
25 G I -1.8653
26 N I -1.5865
27 K I -1.4827
28 C I 0.0000
29 I I -0.4489
30 L I -1.1694
31 G I -2.0446
32 S I -2.0019
33 D I -2.9322
34 G I -2.7249
35 E I -3.6857
36 K I -3.5073
37 N I -2.1343
38 Q I -1.9266
39 C I -0.8883
40 V I -0.4336
41 T I -0.8822
42 G I -1.4546
43 E I -2.5568
44 G I -1.6232
45 T I -1.2361
46 P I -1.2137
47 K I -1.3281
48 P I -1.2274
49 Q I -2.0020
50 S I -1.5917
51 H I -2.5829
52 N I -2.9339
53 D I -2.9650
54 G I -2.2936
55 D I -2.1765
56 F I -0.5879
57 E I -2.0474
58 E I -2.2632
59 I I -0.6146
60 P I -1.2967
61 E I -2.4307
62 E I -1.8363
63 Y I 0.3569
64 L I 0.1053
65 Q I -1.0776
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018