Project name: query_structure

Status: done

Started: 2026-03-16 23:59:42
Settings
Chain sequence(s) A: MAQVQLVESGGGLVQAGGSLRLSCAASGRTFSNYAMGWFRQAPGKEREFVAAISWTGVSTYYADSVKGRFTISRDNDKNTVYVQMNSLIPEDTAIYYCAAVRARSFSDTYSRVNEYDYWGQGTQVTV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-3.5422
Maximal score value
1.674
Average score
-0.7907
Total score value
-100.42

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7734
2 A A -0.3694
3 Q A -1.0629
4 V A -0.8397
5 Q A -0.7670
6 L A 0.0000
7 V A 1.2116
8 E A 0.0684
9 S A -0.5056
10 G A -1.0641
11 G A -0.8161
12 G A 0.0448
13 L A 1.2227
14 V A 0.5004
15 Q A -0.6553
16 A A -0.5006
17 G A -0.7140
18 G A -0.4663
19 S A -0.9423
20 L A -0.9489
21 R A -2.1292
22 L A 0.0000
23 S A -0.4308
24 C A 0.0000
25 A A -0.1316
26 A A -0.6565
27 S A -1.0403
28 G A -1.6083
29 R A -2.2910
30 T A -1.6421
31 F A 0.0000
32 S A -1.8810
33 N A -2.0182
34 Y A 0.0000
35 A A 0.0000
36 M A 0.0000
37 G A 0.0000
38 W A 0.0000
39 F A 0.0000
40 R A 0.0000
41 Q A -1.7022
42 A A -1.7809
43 P A -1.3189
44 G A -1.8706
45 K A -3.0880
46 E A -3.1884
47 R A -2.0072
48 E A -1.4366
49 F A -0.6275
50 V A 0.0000
51 A A 0.0000
52 A A 0.0000
53 I A 0.0000
54 S A 0.0000
55 W A -0.3156
56 T A 0.2400
57 G A 0.4618
58 V A 1.6740
59 S A 0.8373
60 T A 0.5665
61 Y A 0.0173
62 Y A -0.6459
63 A A -1.2725
64 D A -2.4080
65 S A -1.7921
66 V A 0.0000
67 K A -2.5779
68 G A -1.7803
69 R A -1.3757
70 F A 0.0000
71 T A -0.8284
72 I A 0.0000
73 S A -0.3243
74 R A -1.1447
75 D A -2.5220
76 N A -3.0782
77 D A -3.5422
78 K A -3.3940
79 N A -2.8293
80 T A -1.4494
81 V A 0.0000
82 Y A -0.6571
83 V A 0.0000
84 Q A -1.2425
85 M A 0.0000
86 N A -1.1916
87 S A -0.7294
88 L A 0.0000
89 I A -0.0973
90 P A -0.7474
91 E A -1.5913
92 D A 0.0000
93 T A -0.4026
94 A A 0.0000
95 I A -0.4258
96 Y A 0.0000
97 Y A -0.1591
98 C A 0.0000
99 A A 0.0000
100 A A 0.0000
101 V A 0.0000
102 R A -2.2226
103 A A -1.7128
104 R A -2.5883
105 S A -1.9452
106 F A 0.0000
107 S A -1.3131
108 D A -2.4666
109 T A -2.1431
110 Y A -0.9030
111 S A -1.2118
112 R A -2.4972
113 V A -1.4506
114 N A -2.2354
115 E A -2.5740
116 Y A 0.0000
117 D A -1.3287
118 Y A -0.4688
119 W A 0.0979
120 G A -0.0570
121 Q A -0.8541
122 G A -0.5476
123 T A 0.0000
124 Q A -0.9739
125 V A 0.0000
126 T A 0.1982
127 V A 0.1856
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018