Project name: d727e3567c88e72

Status: done

Started: 2026-07-02 06:00:02
Settings
Chain sequence(s) A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKPIENERMQRARFMRQSNFGTIGQTPETSLAQTESSKKFLRSEELRQRLMSESEAASESRSPSAAAMGPETSGPGPGGDLPVTFWEGQGVGLGPGPGVSAYSFSITAYFPEGAAYKVKVSVTTLGPGPGVLFSGTLRF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-3.6507
Maximal score value
5.9676
Average score
-0.15
Total score value
-30.7547

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3482
2 R A 0.4982
3 V A 2.7603
4 L A 3.3559
5 Y A 3.4915
6 L A 3.5949
7 L A 4.6261
8 F A 5.2660
9 S A 4.8011
10 F A 5.6372
11 L A 5.7876
12 F A 5.9676
13 I A 5.9520
14 F A 5.5627
15 L A 4.7059
16 M A 3.4273
17 P A 2.3618
18 L A 2.4343
19 P A 0.7915
20 G A 0.8535
21 V A 2.4332
22 F A 2.4316
23 G A 0.7341
24 G A 0.1865
25 I A -0.0485
26 G A -0.5534
27 D A -0.2950
28 P A 0.6709
29 V A 1.4559
30 T A 0.2913
31 C A 0.0000
32 L A 1.2953
33 K A -0.5467
34 S A -0.2223
35 G A -0.6233
36 A A 0.0000
37 I A 0.6983
38 C A 0.9939
39 H A 0.4271
40 P A 0.9558
41 V A 2.0316
42 F A 1.6172
43 C A -0.3963
44 P A -1.4412
45 R A -2.8419
46 R A -3.3883
47 Y A -2.8098
48 K A -3.0148
49 Q A -1.7574
50 I A -0.8794
51 G A -0.9742
52 T A -0.6542
53 C A 0.0000
54 G A -0.1761
55 L A 0.7610
56 P A 0.2604
57 G A 0.3513
58 T A 0.3437
59 K A -0.3055
60 C A 0.0000
61 C A 0.0000
62 K A -2.1377
63 K A -3.2687
64 P A -2.6944
65 E A -2.6402
66 A A -1.6071
67 A A -1.0017
68 K A -1.8092
69 P A -0.7638
70 I A 0.0781
71 E A -2.1710
72 N A -2.4536
73 E A -3.5374
74 R A -3.6507
75 M A -2.2888
76 Q A -2.8646
77 R A -2.9956
78 A A -2.0225
79 R A -2.3807
80 F A -0.4930
81 M A -0.4610
82 R A -2.2573
83 Q A -1.6836
84 S A -0.8552
85 N A -0.7806
86 F A 0.7256
87 G A 0.2275
88 T A 0.5066
89 I A 1.5292
90 G A -0.2104
91 Q A -1.2958
92 T A -1.3781
93 P A -1.3014
94 E A -1.8238
95 T A -0.9079
96 S A -0.7173
97 L A 0.1555
98 A A -0.7348
99 Q A -1.6658
100 T A -1.6028
101 E A -2.5519
102 S A -1.8343
103 S A -1.5797
104 K A -2.9261
105 K A -2.7440
106 F A -0.1856
107 L A -0.9310
108 R A -2.7777
109 S A -1.9970
110 E A -3.1278
111 E A -3.2857
112 L A -1.4633
113 R A -2.8986
114 Q A -3.2771
115 R A -2.7752
116 L A -1.0992
117 M A -0.9138
118 S A -1.8021
119 E A -2.4438
120 S A -1.5891
121 E A -2.4318
122 A A -1.9294
123 A A -1.6093
124 S A -2.0086
125 E A -2.7945
126 S A -2.1235
127 R A -2.6445
128 S A -1.6385
129 P A -0.9318
130 S A -0.5458
131 A A -0.0885
132 A A 0.2821
133 A A 0.5260
134 M A 0.8064
135 G A -0.5150
136 P A -1.1695
137 E A -2.1853
138 T A -1.3236
139 S A -1.0238
140 G A -1.1026
141 P A -1.1102
142 G A -1.1062
143 P A -0.9387
144 G A -1.1592
145 G A -1.5131
146 D A -1.2862
147 L A 0.8877
148 P A 1.0606
149 V A 2.3845
150 T A 1.7010
151 F A 2.4639
152 W A 1.0107
153 E A -1.4057
154 G A -1.2677
155 Q A -1.5882
156 G A -0.2354
157 V A 1.3203
158 G A 0.8393
159 L A 1.3274
160 G A 0.0975
161 P A -0.3849
162 G A -0.4596
163 P A -0.5143
164 G A 0.2522
165 V A 1.6807
166 S A 1.1262
167 A A 1.1958
168 Y A 1.4478
169 S A 0.3692
170 F A 0.1409
171 S A -0.4929
172 I A 0.4291
173 T A 0.2682
174 A A 1.1600
175 Y A 1.2528
176 F A 0.4876
177 P A -0.7245
178 E A -1.8060
179 G A -0.8350
180 A A -0.1791
181 A A 0.4795
182 Y A 0.7856
183 K A -0.9548
184 V A -0.5104
185 K A -1.3592
186 V A -0.0003
187 S A 0.1986
188 V A 0.7457
189 T A 1.0127
190 T A 1.1998
191 L A 1.5305
192 G A 0.1483
193 P A -0.4259
194 G A -0.4571
195 P A -0.2244
196 G A 0.8152
197 V A 2.6761
198 L A 3.2646
199 F A 3.1131
200 S A 1.6513
201 G A 0.4967
202 T A 0.2174
203 L A 0.4547
204 R A -0.8491
205 F A 0.9943
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018