Project name: d74d82f16635083

Chain sequence(s)	A: SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)

• Minimal score value: -3.5107
• Maximal score value: 1.9515
• Average score: -0.4187
• Total score value: -37.6854

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.0141
2	S	A	0.2428
3	V	A	0.4235
4	Q	A	-0.4985
5	T	A	-0.1379
6	A	A	-0.1418
7	A	A	0.0848
8	T	A	0.2116
9	S	A	0.2597
10	W	A	0.3703
11	G	A	0.1820
12	T	A	0.5198
13	V	A	1.2592
14	P	A	0.7067
15	S	A	0.0777
16	I	A	0.4047
17	R	A	0.0084
18	V	A	0.0822
19	Y	A	0.0000
20	T	A	-1.0851
21	A	A	0.0000
22	N	A	-2.2377
23	N	A	-2.4253
24	G	A	-2.8770
25	K	A	-3.5107
26	I	A	0.0000
27	T	A	-1.3838
28	E	A	0.0000
29	R	A	-0.6813
30	C	A	0.0000
31	W	A	-0.0884
32	D	A	-0.7038
33	G	A	-0.6598
34	K	A	-1.6013
35	G	A	-0.6202
36	W	A	0.2743
37	Y	A	0.3504
38	T	A	-0.1353
39	G	A	-0.3323
40	A	A	-0.4485
41	F	A	0.0000
42	N	A	-1.8583
43	E	A	-1.5928
44	P	A	-2.2763
45	G	A	0.0000
46	D	A	-3.3746
47	N	A	-2.5344
48	V	A	0.0000
49	S	A	-0.3230
50	V	A	0.1395
51	T	A	0.0758
52	S	A	0.4258
53	W	A	1.2871
54	L	A	1.6783
55	V	A	1.9515
56	G	A	0.6498
57	S	A	0.3215
58	A	A	0.5037
59	I	A	0.5826
60	H	A	0.2512
61	I	A	0.0000
62	R	A	-0.3408
63	V	A	0.0000
64	Y	A	0.0778
65	A	A	0.0000
66	S	A	-1.2525
67	T	A	-1.4991
68	G	A	-1.1990
69	T	A	-0.7736
70	T	A	-0.5402
71	T	A	-0.3271
72	T	A	-0.2709
73	E	A	-0.2881
74	W	A	-0.5829
75	C	A	0.0000
76	W	A	-0.9641
77	D	A	-1.2849
78	G	A	-1.5311
79	N	A	-1.8245
80	G	A	-1.0415
81	W	A	-0.9723
82	T	A	-1.1454
83	K	A	-1.5816
84	G	A	-0.6168
85	A	A	0.0229
86	Y	A	0.5943
87	T	A	0.1815
88	A	A	-0.2029
89	T	A	-0.7071
90	N	A	-1.3982