Project name: hIGF2 [mutate: FR19A, VA20A, YD27A, FN28A]

Chain sequence(s)	A: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	VA20A,FN28A,FR19A,YD27A
Energy difference between WT (input) and mutated protein (by FoldX)	1.65817 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:20)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:45)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -2.2212
• Maximal score value: 1.4137
• Average score: -0.5432
• Total score value: -36.3941

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	0.2179
2	Y	A	0.5640
3	R	A	-1.7313
4	P	A	-0.6309
5	S	A	-0.5920
6	E	A	-1.8715
7	T	A	-0.3521
8	L	A	0.3145
9	C	A	0.3476
10	G	A	-0.4874
11	G	A	-0.8910
12	E	A	-1.9067
13	L	A	0.0000
14	V	A	0.4427
15	D	A	-1.4781
16	T	A	-0.2729
17	L	A	0.0000
18	Q	A	-1.7117
19	R	A	-1.9884	mutated: FR19A
20	A	A	-0.3119	mutated: VA20A
21	C	A	0.0000
22	G	A	-0.5360
23	D	A	-2.1116
24	R	A	-1.9125
25	G	A	-0.3910
26	F	A	0.0494
27	D	A	-1.8149	mutated: YD27A
28	N	A	-0.9003	mutated: FN28A
29	S	A	-0.4442
30	R	A	-0.7922
31	P	A	-0.3733
32	A	A	-0.2358
33	S	A	-0.4255
34	R	A	-1.5303
35	V	A	1.3892
36	S	A	-0.2382
37	R	A	-2.2212
38	R	A	-2.2026
39	S	A	-0.5543
40	R	A	-0.4408
41	G	A	-0.1592
42	I	A	0.3115
43	V	A	0.0958
44	E	A	-1.5096
45	E	A	0.0000
46	C	A	0.0000
47	C	A	0.6307
48	F	A	1.4137
49	R	A	-1.5187
50	S	A	-0.4419
51	C	A	0.0000
52	D	A	-1.0004
53	L	A	0.6837
54	A	A	0.0396
55	L	A	0.1807
56	L	A	0.0000
57	E	A	-1.8262
58	T	A	-0.4028
59	Y	A	0.0000
60	C	A	0.2277
61	A	A	0.0671
62	T	A	-0.1164
63	P	A	-0.2638
64	A	A	-0.3362
65	K	A	-1.7345
66	S	A	-0.8512
67	E	A	-1.8584