Project name: obj1 [mutate: GD8C, LD4C, VP5C, EV6C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GD8C,EV6C,VP5C,LD4C
Energy difference between WT (input) and mutated protein (by FoldX)	16.9114 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:38)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)

• Minimal score value: -3.3343
• Maximal score value: 1.6522
• Average score: -0.71
• Total score value: -85.2014

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0228
2	V	C	-0.9503
3	Q	C	-1.5829
4	D	C	0.0000	mutated: LD4C
5	P	C	-0.6232	mutated: VP5C
6	V	C	-0.2740	mutated: EV6C
7	S	C	-1.0432
8	D	C	-1.7927	mutated: GD8C
9	G	C	-0.4255
10	G	C	0.6738
11	L	C	1.4398
12	V	C	-0.0409
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9827
17	S	C	-1.1764
18	L	C	-1.0474
19	R	C	-2.1326
20	L	C	0.0000
21	S	C	-0.8699
22	C	C	0.0000
23	A	C	-0.5934
24	A	C	0.0000
25	S	C	-0.3881
26	D	C	0.0000
27	F	C	1.5441
28	T	C	0.2505
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1451
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2987
40	A	C	-0.9857
41	P	C	-1.2937
42	G	C	-1.4355
43	K	C	-2.1367
44	G	C	-1.0627
45	L	C	0.3875
46	E	C	-0.3945
47	W	C	0.3388
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5836
53	G	C	-1.2447
54	S	C	-1.2291
55	G	C	-1.0828
56	G	C	-0.7350
57	S	C	-0.3030
58	T	C	0.1982
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6461
70	I	C	0.0000
71	S	C	-0.5732
72	R	C	-1.3655
73	D	C	-1.9821
74	N	C	-2.1905
75	S	C	-1.7905
76	K	C	-2.3173
77	N	C	-1.6480
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6801
81	L	C	0.0000
82	Q	C	-1.1332
83	M	C	0.0000
84	N	C	-1.2985
85	S	C	-1.2345
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4216
92	A	C	0.0000
93	I	C	1.0788
94	Y	C	0.0000
95	Y	C	0.5493
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1943
101	D	C	-3.3343
102	G	C	-2.0863
103	F	C	-1.2307
104	N	C	-2.4282
105	K	C	-3.1855
106	G	C	-1.9092
107	F	C	-0.9915
108	D	C	-1.1180
109	Y	C	-0.2319
110	W	C	0.3977
111	G	C	-0.4246
112	Q	C	-1.1466
113	G	C	-0.0317
114	T	C	0.2837
115	L	C	1.6522
116	V	C	0.0000
117	T	C	0.3382
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602