Project name: obj1 [mutate: GD8C, LD4C, VP5C, EV6C]

Status: done

Started: 2025-02-10 14:23:09
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues GD8C,EV6C,VP5C,LD4C
Energy difference between WT (input) and mutated protein (by FoldX) 16.9114 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:38)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)
Show buried residues

Minimal score value
-3.3343
Maximal score value
1.6522
Average score
-0.71
Total score value
-85.2014

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.0228
2 V C -0.9503
3 Q C -1.5829
4 D C 0.0000 mutated: LD4C
5 P C -0.6232 mutated: VP5C
6 V C -0.2740 mutated: EV6C
7 S C -1.0432
8 D C -1.7927 mutated: GD8C
9 G C -0.4255
10 G C 0.6738
11 L C 1.4398
12 V C -0.0409
13 Q C -1.3371
14 P C -1.4887
15 G C -1.4134
16 G C -0.9827
17 S C -1.1764
18 L C -1.0474
19 R C -2.1326
20 L C 0.0000
21 S C -0.8699
22 C C 0.0000
23 A C -0.5934
24 A C 0.0000
25 S C -0.3881
26 D C 0.0000
27 F C 1.5441
28 T C 0.2505
29 F C 0.0000
30 R C -2.0325
31 S C -0.8863
32 Y C -1.2160
33 E C -1.1451
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.2987
40 A C -0.9857
41 P C -1.2937
42 G C -1.4355
43 K C -2.1367
44 G C -1.0627
45 L C 0.3875
46 E C -0.3945
47 W C 0.3388
48 V C 0.0000
49 S C 0.0000
50 A C 0.0000
51 I C 0.0000
52 S C -0.5836
53 G C -1.2447
54 S C -1.2291
55 G C -1.0828
56 G C -0.7350
57 S C -0.3030
58 T C 0.1982
59 Y C 0.6077
60 Y C -0.3559
61 A C -1.1386
62 D C -2.3443
63 S C -1.7150
64 V C 0.0000
65 K C -2.3847
66 G C -1.6175
67 R C 0.0000
68 F C 0.0000
69 T C -0.6461
70 I C 0.0000
71 S C -0.5732
72 R C -1.3655
73 D C -1.9821
74 N C -2.1905
75 S C -1.7905
76 K C -2.3173
77 N C -1.6480
78 T C 0.0000
79 L C 0.0000
80 Y C -0.6801
81 L C 0.0000
82 Q C -1.1332
83 M C 0.0000
84 N C -1.2985
85 S C -1.2345
86 L C 0.0000
87 R C -2.4721
88 A C -1.8894
89 E C -2.3444
90 D C 0.0000
91 T C -0.4216
92 A C 0.0000
93 I C 1.0788
94 Y C 0.0000
95 Y C 0.5493
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.1943
101 D C -3.3343
102 G C -2.0863
103 F C -1.2307
104 N C -2.4282
105 K C -3.1855
106 G C -1.9092
107 F C -0.9915
108 D C -1.1180
109 Y C -0.2319
110 W C 0.3977
111 G C -0.4246
112 Q C -1.1466
113 G C -0.0317
114 T C 0.2837
115 L C 1.6522
116 V C 0.0000
117 T C 0.3382
118 V C 0.0000
119 S C -0.7749
120 S C -1.0602
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018