Project name: AL55

Chain sequence(s)	A: NFMLTQPHSVSESPGKTLTISCTGSSASIASHYVQWYQQRPGGAPTTLIYENDQRPSEVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDGNNHWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:22)

• Minimal score value: -3.2329
• Maximal score value: 1.8507
• Average score: -0.8532
• Total score value: -184.2807

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.2556
2	F	A	0.0000
3	M	A	0.9313
4	L	A	0.0000
5	T	A	0.0221
6	Q	A	-0.4919
7	P	A	-0.8093
8	H	A	-1.3261
9	S	A	-0.9413
10	V	A	-0.4558
11	S	A	-0.7011
12	E	A	-0.9600
13	S	A	-1.1125
14	P	A	-1.6249
15	G	A	-1.8193
16	K	A	-2.3407
17	T	A	-1.2627
18	L	A	0.0000
19	T	A	-0.1364
20	I	A	0.0000
21	S	A	-0.2457
22	C	A	0.0000
23	T	A	-0.3132
24	G	A	-0.1573
25	S	A	-0.2408
26	S	A	-0.5668
27	A	A	-0.5316
28	S	A	-0.5421
29	I	A	0.0000
30	A	A	-0.1793
31	S	A	-0.2281
32	H	A	-0.2661
33	Y	A	0.5303
34	V	A	0.0000
35	Q	A	0.0000
36	W	A	0.0000
37	Y	A	-0.0606
38	Q	A	-0.8371
39	Q	A	-1.5823
40	R	A	-2.4557
41	P	A	-1.5663
42	G	A	-1.2491
43	G	A	-1.1574
44	A	A	-0.7178
45	P	A	-0.8563
46	T	A	-0.4199
47	T	A	-0.1809
48	L	A	0.0000
49	I	A	0.0000
50	Y	A	-0.5482
51	E	A	-1.1350
52	N	A	-1.2902
53	D	A	-2.4394
54	Q	A	-2.1682
55	R	A	-2.0191
56	P	A	-1.3907
57	S	A	-1.5463
58	E	A	-2.1810
59	V	A	-1.4770
60	P	A	-1.6671
61	D	A	-2.3829
62	R	A	-1.3703
63	F	A	0.0000
64	S	A	-1.4021
65	G	A	-1.2025
66	S	A	-1.0921
67	I	A	-0.5364
68	D	A	-1.2657
69	S	A	-0.9656
70	S	A	-0.7920
71	S	A	-0.7883
72	N	A	-0.8505
73	S	A	0.0000
74	A	A	0.0000
75	S	A	-0.5197
76	L	A	0.0000
77	T	A	-0.2404
78	I	A	0.0000
79	S	A	-1.3722
80	G	A	-1.6129
81	L	A	0.0000
82	K	A	-2.3160
83	T	A	-1.8742
84	E	A	-2.7493
85	D	A	0.0000
86	E	A	-2.4873
87	A	A	0.0000
88	D	A	-1.6631
89	Y	A	0.0000
90	Y	A	0.2306
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	Y	A	-0.2328
95	D	A	-1.3727
96	G	A	-1.9709
97	N	A	-2.3547
98	N	A	-2.3213
99	H	A	-1.6149
100	W	A	0.5214
101	V	A	0.0000
102	F	A	1.8507
103	G	A	0.6451
104	G	A	-0.3677
105	G	A	-0.5491
106	T	A	0.0000
107	K	A	-1.2714
108	L	A	0.0000
109	T	A	0.0000
110	V	A	0.0000
111	L	A	-0.6046
112	S	A	-0.5801
113	Q	A	-1.0187
114	P	A	-1.2051
115	K	A	-1.9996
116	A	A	-1.1722
117	A	A	-0.8248
118	P	A	0.0000
119	S	A	-0.2697
120	V	A	0.0000
121	T	A	0.1564
122	L	A	0.5238
123	F	A	1.2820
124	P	A	0.4701
125	P	A	0.0000
126	S	A	-1.1152
127	S	A	-1.7870
128	E	A	-2.7715
129	E	A	-2.3410
130	L	A	-2.0851
131	Q	A	-2.5240
132	A	A	-2.1371
133	N	A	-2.8556
134	K	A	-3.0053
135	A	A	0.0000
136	T	A	-0.1024
137	L	A	0.0000
138	V	A	1.2035
139	C	A	0.0000
140	L	A	1.0473
141	I	A	0.0000
142	S	A	-0.7042
143	D	A	-1.8812
144	F	A	0.0000
145	Y	A	0.0000
146	P	A	0.0000
147	G	A	-0.7852
148	A	A	-0.5254
149	V	A	-0.2357
150	T	A	-0.2059
151	V	A	-0.0684
152	A	A	-0.5379
153	W	A	0.0000
154	K	A	-1.2693
155	A	A	0.0000
156	D	A	-1.6948
157	S	A	-1.0947
158	S	A	-0.7118
159	P	A	-0.8914
160	V	A	-0.7858
161	K	A	-1.7633
162	A	A	-0.9715
163	G	A	-0.8801
164	V	A	-0.7884
165	E	A	-1.4524
166	T	A	-0.4912
167	T	A	-0.4371
168	T	A	-0.2961
169	P	A	-0.5741
170	S	A	-1.3078
171	K	A	-2.7040
172	Q	A	-2.1845
173	S	A	-1.6474
174	N	A	-2.2750
175	N	A	-2.6808
176	K	A	-2.4283
177	Y	A	-1.6925
178	A	A	-0.9303
179	A	A	0.0000
180	S	A	0.2526
181	S	A	0.0000
182	Y	A	0.5472
183	L	A	0.0000
184	S	A	-0.4913
185	L	A	-0.8996
186	T	A	-1.8017
187	P	A	-2.4957
188	E	A	-3.2329
189	Q	A	-2.5909
190	W	A	0.0000
191	K	A	-3.1530
192	S	A	-2.5169
193	H	A	-2.5213
194	K	A	-2.5811
195	S	A	-1.5604
196	Y	A	0.0000
197	S	A	-1.1162
198	C	A	0.0000
199	Q	A	-1.2231
200	V	A	0.0000
201	T	A	-0.7241
202	H	A	0.0000
203	E	A	-2.0185
204	G	A	-1.4025
205	S	A	-0.7691
206	T	A	-0.7383
207	V	A	-0.7680
208	E	A	-2.1984
209	K	A	-1.5813
210	T	A	-0.8780
211	V	A	-0.0885
212	A	A	-0.9703
213	P	A	-1.2242
214	T	A	-0.9683
215	E	A	-1.5071
216	C	A	-0.1857