Project name: obj1 [mutate: EF6C, LG11C, LW45C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LW45C,LG11C,EF6C
Energy difference between WT (input) and mutated protein (by FoldX)	26.1566 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:37)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)

• Minimal score value: -3.3306
• Maximal score value: 1.5423
• Average score: -0.7169
• Total score value: -86.0267

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0239
2	V	C	-0.9962
3	Q	C	-1.1881
4	L	C	0.0000
5	V	C	1.1590
6	F	C	0.0000	mutated: EF6C
7	S	C	-0.2024
8	G	C	-0.7885
9	G	C	-0.4075
10	G	C	-0.0816
11	G	C	-0.5899	mutated: LG11C
12	V	C	-1.0029
13	Q	C	-1.7827
14	P	C	-1.7039
15	G	C	-1.4091
16	G	C	-1.1848
17	S	C	-1.2272
18	L	C	-1.1999
19	R	C	-2.1492
20	L	C	0.0000
21	S	C	-0.3997
22	C	C	0.0000
23	A	C	0.0416
24	A	C	0.0000
25	S	C	-0.1293
26	D	C	0.0000
27	F	C	1.5423
28	T	C	0.2494
29	F	C	0.0000
30	R	C	-2.0328
31	S	C	-0.8867
32	Y	C	-1.2168
33	E	C	-1.1447
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.4183
40	A	C	-1.0455
41	P	C	-1.3042
42	G	C	-1.4588
43	K	C	-2.1867
44	G	C	-1.1673
45	W	C	0.1632	mutated: LW45C
46	E	C	-0.4985
47	W	C	0.2849
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5842
53	G	C	-1.2453
54	S	C	-1.2288
55	G	C	-1.0819
56	G	C	-0.7345
57	S	C	-0.3027
58	T	C	0.1987
59	Y	C	0.6074
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6476
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6493
81	L	C	0.0000
82	Q	C	-1.2347
83	M	C	0.0000
84	N	C	-1.3337
85	S	C	-1.2328
86	L	C	0.0000
87	R	C	-2.4813
88	A	C	-1.9087
89	E	C	-2.3548
90	D	C	0.0000
91	T	C	-0.6972
92	A	C	0.0000
93	I	C	0.9828
94	Y	C	0.0000
95	Y	C	0.5941
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1837
101	D	C	-3.3306
102	G	C	-2.0850
103	F	C	-1.2304
104	N	C	-2.4263
105	K	C	-3.1803
106	G	C	-1.8961
107	F	C	-1.0261
108	D	C	-1.1695
109	Y	C	-0.3756
110	W	C	0.3016
111	G	C	-0.0263
112	Q	C	-0.7907
113	G	C	0.1688
114	T	C	0.6765
115	L	C	1.4518
116	V	C	0.0000
117	T	C	-0.4557
118	V	C	0.0000
119	S	C	-1.2074
120	S	C	-1.0899