Project name: 6b5b3c05bc2c07c [mutate: VI41A, FY217A]

Status: done

Started: 2026-07-18 23:25:33
Settings
Chain sequence(s) A: YPQSIDWRAKGAVTPVKNQGACGSWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues FY217A,VI41A
Energy difference between WT (input) and mutated protein (by FoldX) 0.0243796 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:01:20)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:51)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:05)
Show buried residues

Minimal score value
-2.5747
Maximal score value
1.2911
Average score
-0.6484
Total score value
-140.0531

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 0.7157
2 P A -0.1688
3 Q A -1.1046
4 S A -0.6834
5 I A 0.0000
6 D A -1.0076
7 W A -1.1763
8 R A -1.4618
9 A A -1.2966
10 K A -1.9899
11 G A -1.3243
12 A A 0.0000
13 V A -0.5419
14 T A 0.0000
15 P A -0.6599
16 V A -0.7833
17 K A -0.9588
18 N A -1.6242
19 Q A -1.2162
20 G A -1.1698
21 A A -0.6121
22 C A 0.0000
23 G A -0.9863
24 S A 0.0000
26 W A 0.0000
27 A A 0.0000
28 F A 0.0000
29 S A 0.0000
30 T A 0.0000
31 I A 0.0000
32 A A -0.1605
33 T A 0.0000
34 V A 0.0000
35 E A 0.0000
36 G A 0.0000
37 I A 0.0000
38 N A 0.0000
39 K A -0.2805
40 I A 0.4204
41 I A 1.2911 mutated: VI41A
42 T A 0.1759
43 G A -0.5802
44 N A -1.1614
45 L A -0.2591
46 L A -0.6617
47 E A -1.3585
48 L A 0.0000
49 S A 0.0000
50 E A 0.0000
51 Q A 0.0000
52 E A 0.0000
53 L A 0.0000
54 V A 0.0000
55 D A 0.0000
56 C A 0.0000
57 D A 0.0000
58 K A -1.9600
59 H A -1.4973
60 S A 0.0000
61 Y A -0.2482
62 G A 0.0000
63 C A -1.2024
64 K A -1.6894
65 G A -0.8057
66 G A -0.3075
67 Y A 0.4750
68 Q A 0.0000
69 T A -0.4306
70 T A -0.6188
71 S A 0.0000
72 L A 0.0000
73 Q A -1.1832
74 Y A -1.3013
75 V A 0.0000
76 A A 0.0000
77 N A -1.8260
78 N A -1.6070
79 G A 0.0000
80 V A 0.0000
81 H A 0.0000
82 T A 0.0000
83 S A -1.0786
84 K A -1.8385
85 V A -0.8765
86 Y A 0.0000
87 P A -0.6822
88 Y A -0.8796
89 Q A -1.2174
90 A A -1.4370
91 K A -2.2394
92 Q A -1.6083
93 Y A -1.0928
94 K A -1.5688
95 C A -1.1898
96 R A -1.3492
97 A A -1.3102
98 T A -1.2315
99 D A -2.2084
100 K A -1.8565
101 P A -1.3754
102 G A -1.3615
103 P A -1.4739
104 K A -2.2651
105 V A 0.0000
106 K A -1.2105
107 I A 0.0000
108 T A -0.1229
109 G A -0.4408
110 Y A -0.5192
111 K A -1.6698
112 R A -1.9434
113 V A 0.0000
114 P A -1.0229
115 S A -1.2349
116 N A -1.7394
118 E A -1.1450
119 T A -0.4620
120 S A -0.5389
121 F A 0.0000
122 L A 0.0000
123 G A -0.1341
124 A A -0.4640
125 L A 0.0000
126 A A -0.5065
127 N A -0.9863
128 Q A 0.0000
129 P A 0.0000
130 L A 0.0000
131 S A 0.0000
132 V A 0.0000
133 L A -0.2804
134 V A 0.0000
135 E A 0.0000
136 A A 0.0000
137 G A -1.6709
138 G A -1.3885
139 K A -1.7566
140 P A -1.1702
141 F A 0.0000
142 Q A -0.8701
143 L A 0.1257
144 Y A 0.0000
145 K A -2.0539
146 S A -1.3212
147 G A -1.0485
148 V A -1.1556
149 F A 0.0000
150 D A -2.0283
151 G A -1.3468
152 P A -1.0058
153 C A -1.0247
154 G A -0.8489
155 T A -1.2487
156 K A -2.0665
157 L A -1.3946
158 D A -2.1277
159 H A -1.1334
160 A A 0.0000
161 V A 0.0000
162 T A 0.0000
163 A A 0.0000
164 V A 0.0000
165 G A 0.0000
166 Y A 0.0000
167 G A 0.0000
168 T A -1.3114
169 S A -1.5023
170 D A -2.3726
171 G A -1.8686
172 K A -1.9419
173 N A -1.6296
174 Y A -0.9088
175 I A 0.0000
176 I A 0.0000
177 I A 0.0000
178 K A 0.0000
179 N A 0.0000
180 S A 0.0000
181 W A -0.9693
182 G A 0.0000
183 P A -1.7584
184 N A -2.2446
185 W A 0.0000
186 G A -1.8059
187 E A -2.0989
188 K A -2.5747
189 G A 0.0000
190 Y A 0.0000
191 M A 0.0000
192 R A -0.7579
193 L A 0.0000
194 K A -1.3855
195 R A 0.0000
196 Q A -1.5825
197 S A -1.2152
198 G A -1.3655
199 N A -1.9701
200 S A -1.6568
201 Q A -1.7876
202 G A 0.0000
203 T A 0.0000
204 C A 0.0000
205 G A 0.0000
206 V A 0.0000
207 Y A 0.0000
208 K A -0.8418
209 S A -0.5515
210 S A 0.0000
211 Y A -0.6497
212 Y A -0.3698
213 P A 0.0000
214 F A 0.8377
215 K A 0.0000
216 G A 0.4122
217 Y A 1.1223 mutated: FY217A
218 A A 0.6194
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018