Project name: Mb5-11_I18L_I104L_VLFFLI_Lib3_Top3

Status: done

Started: 2026-07-06 07:00:21
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPLSINYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.8075
Maximal score value
1.4287
Average score
-0.7233
Total score value
-78.8423

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3923
2 Q A -0.8191
3 A A -0.8970
4 N A -1.6275
5 S A -1.2453
6 G A -1.4682
7 S A -1.2491
8 L A 0.0000
9 E A -1.8184
10 V A -0.4324
11 V A 0.0606
12 E A -1.3960
13 A A -1.1905
14 S A -1.5364
15 P A -1.9348
16 T A -1.2048
17 S A -1.1600
18 L A 0.0000
19 Q A -0.7944
20 V A 0.0000
21 S A -1.1355
22 W A 0.0000
23 D A -2.4859
24 A A -1.4882
25 F A 0.0000
26 H A -1.0098
27 R A -0.2884
28 Y A 0.8366
29 H A 0.1404
30 N A -0.6173
31 G A 0.0693
32 F A 1.4287
33 T A 0.6797
34 H A 0.1306
35 P A -0.4147
36 V A -0.9522
37 R A -1.4303
38 Y A -0.8524
39 Y A 0.0000
40 R A -0.7976
41 L A 0.0000
42 T A 0.0000
43 Y A 0.0000
44 G A -0.7268
45 E A -1.4844
46 T A -1.1999
47 G A -1.2043
48 G A -1.3572
49 N A -1.5246
50 S A -0.8993
51 P A -0.4125
52 V A 0.2633
53 Q A -1.2269
54 E A -1.7676
55 F A -0.5723
56 T A -0.1879
57 V A 0.0000
58 P A -0.9610
59 G A -1.1710
60 S A -1.0971
61 K A -1.4372
62 S A -1.1850
63 T A -0.7778
64 A A 0.0000
65 T A -0.3748
66 F A 0.0000
67 S A -0.7463
68 G A -0.9787
69 L A 0.0000
70 K A -2.3147
71 P A -1.9958
72 G A -1.2854
73 V A -1.1028
74 D A -2.1001
75 Y A 0.0000
76 T A -0.7568
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2854
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5610
85 Y A 0.0000
86 P A -0.4024
87 R A -1.0846
88 Y A 0.7080
89 G A 0.6899
90 Y A 1.1148
91 G A 0.3031
92 E A -0.6701
93 S A 0.0000
94 G A -0.7765
95 P A -0.5117
96 L A -0.3244
97 S A -0.5192
98 I A -0.7534
99 N A -1.5446
100 Y A -1.3912
101 R A -2.5325
102 T A 0.0000
103 E A -2.4894
104 L A -1.2426
105 D A -2.7049
106 K A -2.8075
107 P A -1.7868
108 S A -1.6369
109 Q A -1.6621
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018