Project name: d89d369d06fac6f

Chain sequence(s)	A: SLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:33)

• Minimal score value: -3.5118
• Maximal score value: 1.2031
• Average score: -1.1071
• Total score value: -161.6359

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.8771
2	L	A	0.0000
3	S	A	-0.6632
4	A	A	-0.7454
5	A	A	-0.8135
6	E	A	-1.5882
7	A	A	-1.7810
8	D	A	-2.4942
9	L	A	-1.7673
10	A	A	0.0000
11	G	A	-1.8341
12	K	A	-2.2202
13	S	A	0.0000
14	W	A	0.0000
15	A	A	-0.5932
16	P	A	-0.3900
17	V	A	0.0000
18	F	A	-0.2837
19	A	A	-0.6304
20	N	A	-1.5364
21	K	A	-1.5349
22	N	A	-2.3203
23	A	A	-1.5780
24	N	A	-1.2954
25	G	A	0.0000
26	L	A	-1.7698
27	D	A	-2.0469
28	F	A	0.0000
29	L	A	0.0000
30	V	A	0.0000
31	A	A	-1.4811
32	L	A	0.0000
33	F	A	0.0000
34	E	A	-2.7771
35	K	A	-2.7478
36	F	A	-1.8026
37	P	A	-2.0485
38	D	A	-2.5748
39	S	A	0.0000
40	A	A	0.0000
41	N	A	-1.8685
42	F	A	0.0598
43	F	A	-0.2314
44	A	A	-0.4505
45	D	A	-1.4574
46	F	A	0.0000
47	K	A	-2.6536
48	G	A	-2.1906
49	K	A	-2.3679
50	S	A	-1.7050
51	V	A	-1.3046
52	A	A	-1.2492
53	D	A	-2.1357
54	I	A	0.0000
55	K	A	-2.6096
56	A	A	-1.3769
57	S	A	-1.6690
58	P	A	-1.6952
59	K	A	-2.2869
60	L	A	0.0000
61	R	A	-3.5118
62	D	A	-3.3790
63	V	A	0.0000
64	S	A	0.0000
65	S	A	-2.2557
66	R	A	-2.5256
67	I	A	-1.2608
68	F	A	0.0000
69	T	A	-1.6520
70	R	A	-2.5092
71	L	A	0.0000
72	N	A	-2.0018
73	E	A	-2.9537
74	F	A	0.0000
75	V	A	0.0000
76	N	A	-2.6764
77	N	A	-1.9811
78	A	A	0.0000
79	A	A	-1.3603
80	N	A	-1.7728
81	A	A	-1.1986
82	G	A	-1.5988
83	K	A	-2.4036
84	M	A	0.0000
85	S	A	-1.0130
86	A	A	-0.8714
87	M	A	-1.0730
88	L	A	-1.0234
89	S	A	-1.3515
90	Q	A	-2.1920
91	F	A	-1.6495
92	A	A	0.0000
93	K	A	-3.0317
94	E	A	-2.6673
95	H	A	-1.3446
96	V	A	-1.2579
97	G	A	-0.7643
98	F	A	1.2031
99	G	A	0.2809
100	V	A	-0.0391
101	G	A	-1.0907
102	S	A	0.0000
103	A	A	-1.2267
104	Q	A	-0.9705
105	F	A	-1.2417
106	E	A	-2.1663
107	N	A	-1.6674
108	V	A	0.0000
109	R	A	-1.5986
110	S	A	-1.1460
111	M	A	0.0000
112	F	A	0.0000
113	P	A	-0.9576
114	G	A	-0.7715
115	F	A	0.0000
116	V	A	0.0000
117	A	A	-0.2337
118	S	A	-0.0031
119	V	A	0.3742
120	A	A	0.2659
121	A	A	0.0587
122	P	A	-0.7592
123	P	A	-0.7547
124	A	A	-0.5109
125	G	A	-1.1788
126	A	A	0.0000
127	D	A	-2.1541
128	A	A	-1.2981
129	A	A	0.0000
130	W	A	0.0000
131	T	A	-1.3436
132	K	A	-1.4205
133	L	A	0.0000
134	F	A	0.0000
135	G	A	-1.0855
136	L	A	-0.7420
137	I	A	0.0000
138	I	A	0.0000
139	D	A	-2.4315
140	A	A	-1.9589
141	L	A	0.0000
142	K	A	-3.0296
143	A	A	-1.9961
144	A	A	-2.3259
145	G	A	-2.0889
146	K	A	-2.9594