Project name: G4S4 x4-141VHH

Chain sequence(s)	A: GGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASLEHVAIGWFRQAPGKEREGVSCISSSGGHIHYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAAAVSYWECYDKLDYWGQGTLVTVSSPP
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:53)

• Minimal score value: -2.404
• Maximal score value: 1.7625
• Average score: -0.3533
• Total score value: -49.8112

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.5519
2	G	A	-0.6371
3	G	A	-0.6377
4	G	A	-0.5915
5	S	A	-0.3832
6	G	A	-0.5899
7	G	A	-0.6358
8	G	A	-0.6361
9	G	A	-0.5901
10	S	A	-0.3826
11	G	A	-0.5906
12	G	A	-0.6374
13	G	A	-0.6372
14	G	A	-0.5913
15	S	A	-0.3858
16	G	A	-0.5902
17	G	A	-0.6357
18	G	A	-0.6371
19	G	A	-0.5911
20	S	A	-0.6287
21	E	A	-1.7938
22	V	A	-0.1379
23	Q	A	-0.8436
24	L	A	0.0000
25	V	A	1.7377
26	E	A	0.1073
27	S	A	-0.2435
28	G	A	-0.3735
29	G	A	-0.2780
30	G	A	0.0587
31	L	A	1.5105
32	V	A	0.0000
33	Q	A	-1.2406
34	P	A	-0.5346
35	G	A	-0.5397
36	G	A	-0.1721
37	S	A	-0.1818
38	L	A	-0.1257
39	R	A	-1.8479
40	L	A	0.0000
41	S	A	-0.0135
42	C	A	0.0000
43	A	A	0.0290
44	A	A	-0.0202
45	S	A	-0.0949
46	L	A	0.0866
47	E	A	-1.8978
48	H	A	-1.2188
49	V	A	0.0000
50	A	A	0.0000
51	I	A	0.0000
52	G	A	0.0000
53	W	A	0.0000
54	F	A	0.2172
55	R	A	0.0000
56	Q	A	-0.7728
57	A	A	-0.1471
58	P	A	-0.3377
59	G	A	-0.8147
60	K	A	-2.1208
61	E	A	-2.4040
62	R	A	-2.0057
63	E	A	-1.0246
64	G	A	-0.2015
65	V	A	0.0000
66	S	A	0.0000
67	C	A	0.0000
68	I	A	0.0000
69	S	A	0.0000
70	S	A	0.0000
71	S	A	-0.2437
72	G	A	-0.2931
73	G	A	-0.6754
74	H	A	-0.9144
75	I	A	0.5056
76	H	A	-0.7661
77	Y	A	0.1667
78	A	A	-0.2513
79	D	A	-1.8137
80	S	A	-0.4664
81	V	A	0.0000
82	K	A	-1.7846
83	G	A	-0.8304
84	R	A	-0.3965
85	F	A	0.0000
86	T	A	-0.0458
87	I	A	0.0000
88	S	A	-0.1614
89	R	A	-0.3669
90	D	A	-0.7477
91	N	A	-1.1963
92	S	A	-0.7007
93	K	A	-1.7995
94	N	A	-0.7730
95	T	A	0.0000
96	V	A	0.0000
97	Y	A	0.1444
98	L	A	0.0000
99	Q	A	-0.6084
100	M	A	0.0000
101	N	A	-0.5624
102	S	A	-0.2959
103	L	A	0.0000
104	R	A	-1.8334
105	A	A	-0.6032
106	E	A	-1.8095
107	D	A	0.0000
108	T	A	-0.0176
109	A	A	0.0000
110	V	A	0.7301
111	Y	A	0.0000
112	Y	A	0.2105
113	C	A	0.0000
114	A	A	0.0000
115	A	A	0.0000
116	A	A	0.0000
117	V	A	1.7625
118	S	A	0.3973
119	Y	A	0.9582
120	W	A	1.1398
121	E	A	-0.7940
122	C	A	0.0000
123	Y	A	0.3007
124	D	A	-1.9884
125	K	A	-1.9945
126	L	A	-0.4541
127	D	A	-1.6764
128	Y	A	0.1960
129	W	A	0.4746
130	G	A	-0.1973
131	Q	A	-1.2247
132	G	A	-0.2753
133	T	A	0.2575
134	L	A	1.6181
135	V	A	0.0000
136	T	A	0.1622
137	V	A	0.0000
138	S	A	-0.1518
139	S	A	-0.2800
140	P	A	-0.3397
141	P	A	-0.3011