Project name: query_structure

Status: done

Started: 2026-03-16 22:47:26
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVSYYVITYGETGGPFWHYQTFTVPGSKSTATISGLKPGVDYTITVYAYSPYYPAPYRSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:32)
Show buried residues

Minimal score value
-2.6799
Maximal score value
1.8182
Average score
-0.312
Total score value
-29.6372

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7874
2 S A 0.7980
3 S A 0.4892
4 V A 0.2024
5 P A 0.0000
6 T A -1.6389
7 K A -2.6799
8 L A 0.0000
9 E A -1.9159
10 V A 0.1267
11 V A 1.5492
12 A A 0.8995
13 A A 0.3125
14 T A -0.5269
15 P A -1.1190
16 T A -0.9923
17 S A -0.5270
18 L A 0.0000
19 L A 0.7588
20 I A 0.0000
21 S A -0.9638
22 W A 0.0000
23 D A -2.6760
24 A A -1.2508
25 P A 0.0242
26 A A 0.4437
27 V A 0.6838
28 T A 0.2056
29 V A 0.0918
30 S A 0.2172
31 Y A -0.2011
32 Y A 0.0000
33 V A 0.1513
34 I A 0.0000
35 T A 0.0000
36 Y A -0.3607
37 G A 0.0000
38 E A -1.6383
39 T A -1.0190
40 G A -0.6204
41 G A -0.3325
42 P A 0.5830
43 F A 1.8182
44 W A 1.4214
45 H A -0.2054
46 Y A -0.0795
47 Q A -0.8643
48 T A -0.4049
49 F A 0.2515
50 T A 0.2972
51 V A 0.0000
52 P A -0.6544
53 G A -0.6119
54 S A -1.0864
55 K A -2.0399
56 S A -1.4115
57 T A -0.7750
58 A A 0.0000
59 T A 0.2424
60 I A 0.0000
61 S A -0.6591
62 G A -1.0256
63 L A 0.0000
64 K A -2.3898
65 P A -1.6530
66 G A -1.4573
67 V A -1.4710
68 D A -2.1701
69 Y A 0.0000
70 T A -1.0062
71 I A 0.0000
72 T A -0.0442
73 V A 0.0000
74 Y A 0.0000
75 A A 0.0000
76 Y A 0.0980
77 S A 0.0000
78 P A 0.5290
79 Y A 1.3645
80 Y A 1.6505
81 P A 0.8313
82 A A 0.6233
83 P A 0.5783
84 Y A 0.7092
85 R A -1.0562
86 S A -0.5299
87 S A -0.3962
88 P A -0.3050
89 I A 0.0350
90 S A -0.5557
91 I A -0.7004
92 N A -1.7649
93 Y A -1.5275
94 R A -2.5827
95 T A -1.5208
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018