Project name: RSF1 (cryptic)

Chain sequence(s)	A: FKMATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEGSRGGRCCGSVIRRLLLLTHYCSLSPRNKSVRKPCSSYGFEGYRKNTRGAGGGSSPKLNHSNEPQHKIPGKGVC
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:10)

• Minimal score value: -3.3696
• Maximal score value: 2.3431
• Average score: -0.7473
• Total score value: -103.134

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	F	A	1.3815
2	K	A	-0.2518
3	M	A	0.7009
4	A	A	0.4536
5	T	A	0.0639
6	A	A	0.2900
7	A	A	0.1513
8	A	A	0.4467
9	A	A	0.8357
10	A	A	0.9659
11	A	A	1.2944
12	V	A	2.3431
13	M	A	1.8357
14	A	A	0.6701
15	P	A	-0.0004
16	P	A	-0.4541
17	G	A	-0.4793
18	C	A	0.1441
19	P	A	-0.2852
20	G	A	-0.6532
21	S	A	-0.5447
22	C	A	-0.1725
23	P	A	-0.1009
24	N	A	-0.7219
25	F	A	-0.0936
26	A	A	0.3693
27	V	A	0.7649
28	V	A	0.0000
29	C	A	0.0000
30	S	A	-0.5446
31	F	A	0.0000
32	L	A	-0.7569
33	E	A	-2.1757
34	R	A	-0.9298
35	Y	A	-0.1129
36	G	A	0.0000
37	P	A	-0.7097
38	L	A	0.8680
39	L	A	0.1365
40	D	A	-1.3236
41	L	A	-0.5910
42	P	A	-1.2592
43	E	A	-2.1052
44	L	A	-0.7064
45	P	A	-0.2635
46	F	A	0.6234
47	P	A	-0.9105
48	E	A	-2.0454
49	L	A	0.0000
50	E	A	-2.2692
51	R	A	-2.9229
52	V	A	-1.3597
53	L	A	0.0000
54	Q	A	-2.2569
55	A	A	-1.4166
56	P	A	-1.2810
57	P	A	-0.9920
58	P	A	-0.9275
59	D	A	-1.2598
60	V	A	0.2712
61	G	A	-0.9099
62	N	A	-1.7899
63	G	A	-2.0281
64	E	A	-2.6349
65	G	A	-2.2013
66	S	A	-2.0531
67	R	A	-2.8018
68	G	A	-2.2267
69	G	A	-2.0017
70	R	A	-2.3767
71	C	A	-0.6832
72	C	A	-0.7898
73	G	A	-1.3706
74	S	A	-1.2618
75	V	A	-0.5594
76	I	A	-0.4934
77	R	A	-1.7751
78	R	A	-1.4198
79	L	A	-0.1088
80	L	A	0.1409
81	L	A	0.2699
82	L	A	0.6484
83	T	A	0.4590
84	H	A	0.5502
85	Y	A	1.8964
86	C	A	1.5234
87	S	A	0.6772
88	L	A	1.4056
89	S	A	0.0525
90	P	A	-1.0839
91	R	A	-2.8565
92	N	A	-3.1101
93	K	A	-2.7829
94	S	A	-1.4311
95	V	A	-0.3058
96	R	A	-2.2939
97	K	A	-2.1232
98	P	A	-1.0870
99	C	A	-0.2422
100	S	A	0.0922
101	S	A	-0.1794
102	Y	A	0.8326
103	G	A	0.3397
104	F	A	0.9270
105	E	A	-1.3232
106	G	A	-0.8829
107	Y	A	-0.5362
108	R	A	-2.8326
109	K	A	-3.3696
110	N	A	-2.9596
111	T	A	-2.4559
112	R	A	-2.8244
113	G	A	-1.6227
114	A	A	-0.8855
115	G	A	-0.8708
116	G	A	-0.9696
117	G	A	-0.9519
118	S	A	-0.9075
119	S	A	-0.8086
120	P	A	-0.9742
121	K	A	-1.6060
122	L	A	-0.2681
123	N	A	-1.7146
124	H	A	-2.0058
125	S	A	-1.8846
126	N	A	-2.8585
127	E	A	-3.0614
128	P	A	-2.4773
129	Q	A	-2.5307
130	H	A	-2.1783
131	K	A	-1.6693
132	I	A	0.3293
133	P	A	-0.5554
134	G	A	-0.9841
135	K	A	-1.6098
136	G	A	-0.4194
137	V	A	1.4722
138	C	A	1.4974