Project name: d7d674389b61e0ba8072fdf0c0413599

Status: done

Started: 2026-03-07 00:21:57
Settings
Chain sequence(s) B: SRQREEKWSALLRSAFESPSLATQEALRKALGVDPSRLSEILSPTLLKSEISELSRRIAEATGKEPEEVKKALEEFIKKIESGSGC
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:19)
Show buried residues

Minimal score value
-4.3722
Maximal score value
1.2375
Average score
-1.7118
Total score value
-147.2182

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -2.5156
2 R B -4.0293
3 Q B -4.1658
4 R B -4.3438
5 E B -3.9601
6 E B -4.3722
7 K B -3.8050
8 W B -2.9887
9 S B 0.0000
10 A B -1.6185
11 L B -1.2274
12 L B 0.0000
13 R B -1.4854
14 S B -0.8120
15 A B 0.0000
16 F B -0.8156
17 E B -2.0150
18 S B -0.7674
19 P B -0.2797
20 S B 0.3248
21 L B 1.2375
22 A B 0.4586
23 T B 0.0000
24 Q B -0.6232
25 E B -1.1782
26 A B -1.0467
27 L B 0.0000
28 R B -2.3707
29 K B -2.5612
30 A B -1.7600
31 L B 0.0000
32 G B -1.8112
33 V B 0.0000
34 D B -2.9578
35 P B -2.4470
36 S B -2.0422
37 R B -2.7999
38 L B 0.0000
39 S B -1.8966
40 E B -2.3835
41 I B -1.4735
42 L B 0.0000
43 S B -0.9248
44 P B -1.1609
45 T B -0.7970
46 L B 0.0000
47 L B 0.0000
48 K B -2.4701
49 S B -1.8980
50 E B -3.0387
51 I B 0.0000
52 S B -1.7389
53 E B -2.1459
54 L B 0.0000
55 S B 0.0000
56 R B -3.5088
57 R B -3.0595
58 I B 0.0000
59 A B 0.0000
60 E B -3.2630
61 A B -2.0506
62 T B -1.9955
63 G B -1.9701
64 K B -3.0252
65 E B -3.7541
66 P B -4.0019
67 E B -4.1906
68 E B -4.3607
69 V B 0.0000
70 K B -3.6133
71 K B -3.8536
72 A B -2.8528
73 L B 0.0000
74 E B -3.1463
75 E B -3.7613
76 F B 0.0000
77 I B 0.0000
78 K B -3.8654
79 K B -3.3744
80 I B 0.0000
81 E B -3.3425
82 S B -2.1604
83 G B -1.6009
84 S B -1.3485
85 G B -0.4154
86 C B 0.0032
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018