Project name: aggregation_propensity_1

Status: done

Started: 2026-07-28 16:58:29
Settings
Chain sequence(s) A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:58)
Show buried residues

Minimal score value
-4.9622
Maximal score value
2.6121
Average score
-0.8548
Total score value
-119.6784

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9544
2 D A 0.0767
3 V A 2.2242
4 F A 2.6121
5 M A 1.6809
6 K A -0.4259
7 G A -0.1331
8 L A 0.5990
9 S A -0.4909
10 K A -2.3088
11 A A -1.6084
12 K A -3.3281
13 E A -2.5145
14 G A -1.0604
15 V A 0.1877
16 V A 0.2703
17 A A -0.1416
18 A A -0.6009
19 A A -2.1003
20 E A -3.3016
21 K A -3.8373
22 T A -2.7123
23 K A -3.1653
24 Q A -2.0653
25 G A -0.7801
26 V A 0.5836
27 A A -0.6719
28 E A -1.7446
29 A A -1.0444
30 A A -0.6899
31 G A -1.1586
32 K A -2.1184
33 T A -0.9741
34 K A -2.0179
35 E A -1.0976
36 G A -0.3369
37 V A 0.8002
38 L A -0.0014
39 Y A 0.3216
40 V A -0.4231
41 G A -0.8055
42 S A -0.6480
43 K A -0.9453
44 T A -1.4646
45 K A -2.1279
46 E A -2.1796
47 G A -0.5896
48 V A 1.0591
49 V A 1.7583
50 H A 0.6024
51 G A 0.5709
52 V A 1.7520
53 A A 1.0874
54 T A 1.0283
55 V A 1.0518
56 A A -0.6744
57 E A -2.4254
58 K A -2.9951
59 T A -2.8270
60 K A -3.3173
61 E A -2.9786
62 Q A -1.7605
63 V A 0.2490
64 T A 0.2185
65 N A 0.1788
66 V A 1.4995
67 G A 1.2365
68 G A 0.9615
69 A A 0.9936
70 V A 1.6794
71 V A 1.4445
72 T A 1.1631
73 G A 1.7728
74 V A 2.1731
75 T A 1.1489
76 A A 0.9640
77 V A 1.3047
78 A A -0.2089
79 Q A -1.3531
80 K A -2.0311
81 T A -1.2973
82 V A -0.6629
83 E A -1.8922
84 G A -0.9492
85 A A -0.4622
86 G A -0.0581
87 S A 0.4843
88 I A 1.7661
89 A A 0.9045
90 A A 0.3191
91 A A 0.4411
92 T A 0.4187
93 G A 0.7554
94 F A 1.4019
95 V A 0.3339
96 K A -2.5814
97 K A -3.8415
98 D A -3.4155
99 Q A -2.6242
100 L A -2.8645
101 G A -3.2130
102 K A -4.0419
103 N A -4.3126
104 E A -4.9622
105 E A -3.4572
106 G A -1.9257
107 A A -1.4818
108 P A -2.1966
109 Q A -2.0053
110 E A -2.1031
111 G A -0.3132
112 I A 1.4024
113 L A 0.5938
114 E A -1.4097
115 D A -1.7068
116 M A -0.0144
117 P A 0.1373
118 V A 0.5309
119 D A -1.5627
120 P A -2.2910
121 D A -3.2114
122 N A -3.3211
123 E A -2.7561
124 A A -0.7328
125 Y A 0.1361
126 E A -0.7525
127 M A -0.1702
128 P A -1.1361
129 S A -1.7511
130 E A -2.6365
131 E A -2.6808
132 G A -1.8190
133 Y A -1.2496
134 Q A -2.3669
135 D A -1.8267
136 Y A -1.0133
137 E A -2.4471
138 P A -2.1850
139 E A -2.4711
140 A A -1.1537
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018