Project name: d93daa329093804

Status: done

Started: 2026-07-02 20:55:38
Settings
Chain sequence(s) B: MSLEELAELIAQRQEAYLAEQFAQLPESEAGRHVWVSGGEVIARSTVVIL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:27)
Show buried residues

Minimal score value
-2.7531
Maximal score value
2.2964
Average score
-0.586
Total score value
-29.2987

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.7468
2 S B -0.1000
3 L B 0.3305
4 E B -1.7195
5 E B -1.6675
6 L B 0.0044
7 A B -0.8371
8 E B -2.2229
9 L B -0.8900
10 I B -0.2387
11 A B -1.4590
12 Q B -2.4296
13 R B -2.5615
14 Q B -2.4037
15 E B -2.7531
16 A B -1.6988
17 Y B -0.7770
18 L B -0.8870
19 A B -1.2278
20 E B -1.8885
21 Q B -1.2065
22 F B -0.4071
23 A B -0.9510
24 Q B -1.7941
25 L B -1.1517
26 P B -1.5317
27 E B -1.8002
28 S B -1.7127
29 E B -2.0609
30 A B -0.5701
31 G B -0.9166
32 R B -1.9899
33 H B -1.0082
34 V B 0.5937
35 W B 1.5261
36 V B 1.8408
37 S B 0.4949
38 G B -0.5674
39 G B -0.6263
40 E B -0.4392
41 V B 1.6741
42 I B 2.2964
43 A B 0.8229
44 R B -1.0390
45 S B -1.0183
46 T B -0.3713
47 V B 0.9087
48 V B 2.1916
49 I B 1.9523
50 L B 2.2420
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018