Project name: d940bb32c8913eb

Chain sequence(s)	A: LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMMENQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:12)

• Minimal score value: -2.3303
• Maximal score value: 1.9947
• Average score: -0.435
• Total score value: -68.2955

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	L	A	1.7231
2	I	A	1.2395
3	V	A	0.0000
4	T	A	-0.2247
5	Q	A	-0.8421
6	T	A	-0.1515
7	M	A	-0.2049
8	K	A	-1.7564
9	G	A	-0.7820
10	L	A	0.0000
11	D	A	-0.6359
12	I	A	-0.0447
13	Q	A	-1.1039
14	K	A	-1.8539
15	V	A	0.0000
16	A	A	0.0010
17	G	A	-0.1450
18	T	A	-0.2195
19	W	A	0.0000
20	Y	A	0.1733
21	S	A	0.0000
22	L	A	0.0000
23	A	A	0.0000
24	M	A	0.0000
25	A	A	0.0000
26	A	A	0.0000
27	S	A	0.0000
28	D	A	-1.1841
29	I	A	1.6755
30	S	A	0.1877
31	L	A	0.1468
32	L	A	0.0000
33	D	A	-1.5701
34	A	A	-0.4120
35	Q	A	-0.9616
36	S	A	-0.2972
37	A	A	0.0000
38	P	A	-0.2052
39	L	A	0.1812
40	R	A	-0.1540
41	V	A	0.1268
42	Y	A	0.0000
43	V	A	0.0000
44	E	A	-1.0448
45	E	A	-1.1881
46	L	A	0.0000
47	K	A	-1.3326
48	P	A	0.0000
49	T	A	-0.0545
50	P	A	-0.5820
51	E	A	-1.8764
52	G	A	-0.4606
53	D	A	-0.6021
54	L	A	0.0000
55	E	A	-1.0435
56	I	A	0.0000
57	L	A	-0.0200
58	L	A	0.0000
59	Q	A	-0.2900
60	K	A	0.0000
61	W	A	-0.1329
62	E	A	-2.0186
63	N	A	-1.8631
64	G	A	-0.9947
65	E	A	-1.7967
66	C	A	-0.1491
67	A	A	-0.1872
68	Q	A	-1.3860
69	K	A	-1.4695
70	K	A	-1.7780
71	I	A	0.2663
72	I	A	0.9437
73	A	A	0.0000
74	E	A	-2.2101
75	K	A	-1.8080
76	T	A	-0.5992
77	K	A	-1.5456
78	I	A	0.4971
79	P	A	-0.1005
80	A	A	0.0000
81	V	A	0.0000
82	F	A	0.0000
83	K	A	-0.9355
84	I	A	-0.1708
85	D	A	-1.9109
86	A	A	-0.1915
87	L	A	1.3182
88	N	A	-1.3135
89	E	A	-2.2420
90	N	A	-0.8150
91	K	A	-0.7252
92	V	A	0.0000
93	L	A	0.0000
94	V	A	0.0000
95	L	A	0.0000
96	D	A	-0.4206
97	T	A	0.0000
98	D	A	-0.3594
99	Y	A	-0.1240
100	K	A	-1.7797
101	K	A	-1.0175
102	Y	A	0.0000
103	L	A	0.0000
104	L	A	0.0000
105	F	A	0.0000
106	C	A	0.0000
107	M	A	0.1251
108	E	A	0.0000
109	N	A	-1.1683
115	Q	A	-1.2049
116	S	A	-0.2536
117	L	A	0.0000
118	A	A	0.0000
119	C	A	0.0000
120	Q	A	0.0000
121	C	A	0.0000
122	L	A	0.0000
123	V	A	0.0000
124	R	A	-0.3072
125	T	A	-0.0954
126	P	A	-0.4171
127	E	A	-1.5843
128	V	A	0.9796
129	D	A	-0.2653
130	D	A	-2.1571
131	E	A	-2.3303
132	A	A	0.0000
133	L	A	-0.0663
134	E	A	-2.0952
135	K	A	-1.1193
136	F	A	0.0000
137	D	A	-1.3457
138	K	A	-1.8870
139	A	A	-0.2965
140	L	A	0.0000
141	K	A	-1.6894
142	A	A	-0.2204
143	L	A	0.1423
144	P	A	-0.1386
145	M	A	-0.0838
146	H	A	-0.9661
147	I	A	0.0000
148	R	A	-1.7894
149	L	A	-0.0753
150	S	A	-0.1576
151	F	A	0.0000
152	N	A	-0.8521
153	P	A	-0.2826
154	T	A	-0.1472
155	Q	A	-0.3228
156	L	A	0.0000
157	E	A	-2.0774
158	E	A	-1.9620
159	Q	A	-1.4551
160	C	A	0.0000
161	H	A	0.0840
162	I	A	1.9947