Project name: obj1 [mutate: WK47C, YH59C, WM110C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	WK47C,YH59C,WM110C
Energy difference between WT (input) and mutated protein (by FoldX)	3.60178 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:49)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:18)

• Minimal score value: -3.3336
• Maximal score value: 1.7556
• Average score: -0.7365
• Total score value: -88.3835

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0060
2	V	C	-0.9394
3	Q	C	-1.2735
4	L	C	0.0000
5	V	C	0.5402
6	E	C	0.2026
7	S	C	-0.4097
8	G	C	-0.8149
9	G	C	0.0110
10	G	C	0.9239
11	L	C	1.4406
12	V	C	-0.0385
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9630
19	R	C	-2.1462
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0327
31	S	C	-0.8866
32	Y	C	-1.2160
33	E	C	-1.1491
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.5994
40	A	C	-1.0139
41	P	C	-1.3128
42	G	C	-1.4432
43	K	C	-2.1451
44	G	C	-1.0607
45	L	C	-0.0385
46	E	C	-1.3393
47	K	C	-1.6176	mutated: WK47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.7886
53	G	C	-1.2493
54	S	C	-1.2334
55	G	C	-1.0899
56	G	C	-0.7473
57	S	C	-0.6645
58	T	C	-0.5475
59	H	C	-0.9184	mutated: YH59C
60	Y	C	-1.3492
61	A	C	-1.8664
62	D	C	-2.4990
63	S	C	-1.7072
64	V	C	0.0000
65	K	C	-2.5829
66	G	C	-1.6113
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.8400
70	I	C	0.0000
71	S	C	-0.5652
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6696
81	L	C	0.0000
82	Q	C	-1.2338
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4335
92	A	C	0.0000
93	I	C	1.0548
94	Y	C	0.0000
95	Y	C	0.3849
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1824
101	D	C	-3.3336
102	G	C	-2.0928
103	F	C	-1.4419
104	N	C	-2.4346
105	K	C	-3.1820
106	G	C	-1.8883
107	F	C	-0.9846
108	D	C	-1.1323
109	Y	C	-0.2807
110	M	C	0.3820	mutated: WM110C
111	G	C	-0.1564
112	Q	C	-0.9223
113	G	C	0.0681
114	T	C	0.5817
115	L	C	1.7556
116	V	C	0.0000
117	T	C	0.3369
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602