Project name: query_structure

Status: done

Started: 2026-03-16 23:55:32
Settings
Chain sequence(s) A: MADVQLVESGGRSVRAGDSLRLSCLASGGTFSLYAMGWFRQAPGKEREFVAAVTWSGGSTYYTDSVKGRFSISRDNAKNTVYLQMNSLKPEDTAVYYCAVRTSGFFGSIPVTERAFDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:25)
Show buried residues

Minimal score value
-3.0117
Maximal score value
1.7691
Average score
-0.695
Total score value
-88.9585

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5988
2 A A -0.4789
3 D A -1.6436
4 V A -1.0055
5 Q A -1.1195
6 L A 0.0000
7 V A 0.5060
8 E A -0.1702
9 S A -0.7255
10 G A -1.6373
11 G A -1.9977
12 R A -2.5927
13 S A -1.7151
14 V A -1.8078
15 R A -2.5081
16 A A -2.1612
17 G A -1.8550
18 D A -2.0402
19 S A -1.8103
20 L A 0.0000
21 R A -2.3978
22 L A 0.0000
23 S A -0.3234
24 C A 0.0000
25 L A 0.4976
26 A A 0.0000
27 S A -0.5587
28 G A -0.8004
29 G A -0.3893
30 T A 0.2846
31 F A 0.0000
32 S A 0.1252
33 L A 1.3583
34 Y A 1.1302
35 A A 0.0000
36 M A 0.0000
37 G A 0.0000
38 W A 0.0000
39 F A 0.0000
40 R A 0.0000
41 Q A -1.6029
42 A A -1.6898
43 P A -1.2208
44 G A -1.7235
45 K A -2.7872
46 E A -3.0117
47 R A -2.1771
48 E A -1.3691
49 F A -0.4700
50 V A 0.0000
51 A A 0.0000
52 A A 0.0000
53 V A 0.0000
54 T A 0.0000
55 W A 0.4053
56 S A -0.2998
57 G A -0.7995
58 G A -0.6691
59 S A -0.2497
60 T A 0.1073
61 Y A 0.3823
62 Y A -0.4049
63 T A -1.0865
64 D A -2.3427
65 S A -1.7456
66 V A 0.0000
67 K A -2.5414
68 G A -1.7949
69 R A -1.4996
70 F A 0.0000
71 S A -0.8640
72 I A 0.0000
73 S A -0.6399
74 R A -1.1969
75 D A -1.8279
76 N A -1.9674
77 A A -1.6301
78 K A -2.2499
79 N A -1.6481
80 T A 0.0000
81 V A 0.0000
82 Y A -0.5319
83 L A 0.0000
84 Q A -1.3058
85 M A 0.0000
86 N A -1.6391
87 S A -1.5283
88 L A 0.0000
89 K A -2.4126
90 P A -1.9886
91 E A -2.3169
92 D A 0.0000
93 T A -1.2912
94 A A 0.0000
95 V A -0.4133
96 Y A 0.0000
97 Y A -0.2229
98 C A 0.0000
99 A A 0.0000
100 V A 0.0000
101 R A 0.0000
102 T A 0.0970
103 S A 0.2955
104 G A 0.6990
105 F A 1.7691
106 F A 1.0952
107 G A 0.4203
108 S A 0.4277
109 I A 1.1583
110 P A 0.0088
111 V A 0.1858
112 T A -0.8647
113 E A -2.2534
114 R A -2.6453
115 A A -1.1123
116 F A 0.0000
117 D A -1.5822
118 Y A -0.2286
119 W A -0.1277
120 G A -0.2095
121 Q A -1.2105
122 G A -0.7079
123 T A 0.0000
124 Q A -1.8173
125 V A 0.0000
126 T A -1.5152
127 V A 0.0000
128 S A -1.3374
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018