Project name: da5ae7068607831

Status: done

Started: 2026-07-01 15:22:02
Settings
Chain sequence(s) B: MNFTLSEELQPDGTGVLTLSALTSELEPNTTLQWLSGGELVSTSQVVVTP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:13)
Show buried residues

Minimal score value
-2.118
Maximal score value
1.4283
Average score
-0.219
Total score value
-10.9494

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.6980
2 N B -0.3198
3 F B 0.8839
4 T B 1.0371
5 L B 1.4283
6 S B -0.3742
7 E B -1.6624
8 E B -1.8158
9 L B -0.3053
10 Q B -1.1281
11 P B -1.3581
12 D B -2.1180
13 G B -1.2476
14 T B -0.8232
15 G B -0.7371
16 V B 0.0456
17 L B 0.4068
18 T B 0.3054
19 L B 1.2111
20 S B 0.7668
21 A B 0.8576
22 L B 1.1323
23 T B 0.2508
24 S B -0.4891
25 E B -0.6086
26 L B -0.7486
27 E B -2.0484
28 P B -1.3176
29 N B -1.2302
30 T B -1.1682
31 T B -1.0118
32 L B -0.4992
33 Q B -0.4826
34 W B 0.9834
35 L B 1.1962
36 S B 0.1259
37 G B -0.7199
38 G B -0.7445
39 E B -1.0291
40 L B 0.8230
41 V B 1.2504
42 S B 0.5482
43 T B -0.1830
44 S B -0.7142
45 Q B -1.1430
46 V B -0.0515
47 V B 0.8419
48 V B 0.2142
49 T B 0.2133
50 P B -0.0905
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018