Project name: lw123 [mutate: VA5A, VR11A, VA57A, VR93A, YA109A]

Status: done

Started: 2026-03-30 15:24:37
Settings
Chain sequence(s) A: EVQLVQSGAEVKKPGASVKVSCKASGYKFTSYVMHWVRQAPGQGLEWMGYINPRNDVTKYAEKFQGRVTLTSDTSTSTAYMELSSLRSEDTAVYYCARGSYYDYEGFVYWGQGTLVTVSS
B: QIQMTQSPSSLSASVGDRVTITCSATSSVSYMHWYQQKPGKAPKRWIYDTSKLASGVPSRFSGSGSGTDYTLTISSLQPEDAATYYCQQWSSNPLTFGGGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues VR11A,VA5A,VR93A,VA57A,YA109A
Energy difference between WT (input) and mutated protein (by FoldX) 2.84149 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:57)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:03:33)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:00)
Show buried residues

Minimal score value
-2.2665
Maximal score value
1.5419
Average score
-0.3269
Total score value
-73.8828

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.7502
2 V A -0.2516
3 Q A -1.1284
4 L A 0.0000
5 A A 0.0482 mutated: VA5A
6 Q A 0.0000
7 S A -0.1498
8 G A -0.4671
9 A A -0.1585
10 E A -1.2652
11 R A -2.1089 mutated: VR11A
12 K A -1.1370
13 K A -1.8106
14 P A -0.5165
15 G A -0.5158
16 A A -0.0842
17 S A -0.0749
18 V A 0.0000
19 K A -1.8205
20 V A 0.0000
21 S A -0.0149
22 C A 0.0000
23 K A -1.3101
24 A A 0.0000
25 S A -0.1588
26 G A -0.3812
27 Y A -0.1786
28 K A -1.6588
29 F A 0.0000
30 T A -0.2565
31 S A 0.0199
32 Y A 0.3816
33 V A 0.0000
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.2077
39 Q A -0.1720
40 A A -0.0618
41 P A -0.3397
42 G A -0.7365
43 Q A -1.3051
44 G A -0.3313
45 L A 0.0000
46 E A -0.3715
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 Y A 0.0000
51 I A 0.0000
52 N A -0.1327
53 P A 0.0000
54 R A -2.0805
55 N A -1.9388
56 D A -2.0156
57 A A -0.3075 mutated: VA57A
58 T A -0.2715
59 K A -1.2702
60 Y A 0.1435
61 A A 0.0000
62 E A -2.2665
63 K A -2.0375
64 F A 0.0000
65 Q A -1.4849
66 G A -0.7679
67 R A -0.5083
68 V A 0.0000
69 T A -0.0570
70 L A 0.0000
71 T A -0.0352
72 S A -0.1788
73 D A -0.7837
74 T A -0.2552
75 S A -0.2318
76 T A -0.0834
77 S A -0.0621
78 T A 0.0000
79 A A 0.0000
80 Y A 0.2048
81 M A 0.0000
82 E A -1.0639
83 L A 0.0000
84 S A -0.1238
85 S A -0.2934
86 L A 0.0000
87 R A -1.8550
88 S A -0.7381
89 E A -1.8307
90 D A 0.0000
91 T A -0.0143
92 A A 0.0000
93 R A -1.3915 mutated: VR93A
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.1983
99 G A 0.0000
100 S A 0.0000
101 Y A 1.5419
102 Y A 1.3105
103 D A -0.5226
104 Y A 0.3620
105 E A -0.3109
106 G A 0.0000
107 F A 0.0000
108 V A 0.2878
109 A A 0.0838 mutated: YA109A
110 W A 0.1259
111 G A 0.0000
112 Q A -1.2083
113 G A -0.2748
114 T A 0.0000
115 L A 0.1638
116 V A 0.0000
117 T A -0.2375
118 V A 0.0000
119 S A -0.1001
120 S A -0.2241
1 Q B -1.1983
2 I B 0.0000
3 Q B -0.9283
4 M B 0.0000
5 T B -0.0709
6 Q B 0.0000
7 S B -0.2071
8 P B -0.1913
9 S B -0.2704
10 S B -0.4281
11 L B 0.1783
12 S B -0.3140
13 A B -0.0497
14 S B 0.1542
15 V B 1.2626
16 G B -0.3378
17 D B -1.2912
18 R B -2.0133
19 V B 0.0000
20 T B -0.0613
21 I B 0.0000
22 T B -0.0241
23 C B 0.0000
24 S B -0.2691
25 A B -0.0231
26 T B -0.0953
27 S B -0.1911
28 S B -0.2643
29 V B 0.0000
30 S B -0.1204
31 Y B 0.4625
32 M B 0.0000
33 H B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 Q B 0.0000
37 Q B 0.0000
38 K B -0.4878
39 P B -0.4228
40 G B -0.8291
41 K B -1.7843
42 A B -0.3074
43 P B 0.0000
44 K B -1.1201
45 R B -0.3887
46 W B 0.0972
47 I B 0.0000
48 Y B 0.0358
49 D B -0.5704
50 T B -0.1568
51 S B -0.5310
52 K B -1.6528
53 L B 0.1469
54 A B 0.0000
55 S B -0.3004
56 G B -0.4748
57 V B 0.0709
58 P B -0.0780
59 S B -0.2881
60 R B -0.3783
61 F B 0.0000
62 S B -0.1704
63 G B -0.1488
64 S B -0.2521
65 G B -0.3687
66 S B -0.3019
67 G B -0.2512
68 T B -0.4045
69 D B -1.7562
70 Y B 0.0000
71 T B -0.0182
72 L B 0.0000
73 T B -0.0271
74 I B 0.0000
75 S B -0.2978
76 S B -0.1702
77 L B 0.0000
78 Q B -0.4404
79 P B -0.5783
80 E B -1.8508
81 D B 0.0000
82 A B -0.1384
83 A B 0.0000
84 T B -0.2787
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 Q B 0.0000
89 Q B 0.0000
90 W B 0.1534
91 S B -0.0942
92 S B -0.3591
93 N B -1.3021
94 P B -0.4043
95 L B 0.0000
96 T B -0.0071
97 F B 0.0000
98 G B 0.0000
99 G B -0.4747
100 G B -0.1313
101 T B 0.0000
102 K B -1.7294
103 V B 0.0000
104 E B -1.3871
105 I B -0.1561
106 K B -1.6192
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018