Project name: Mb5-11_VVVCVC

Status: done

Started: 2026-07-06 06:28:04
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATVSGLKPGVDYTCTVYAVTWYPRYGYGESGPVSCNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Minimal score value
-2.7335
Maximal score value
1.2503
Average score
-0.7657
Total score value
-83.4598

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.1079
2 Q A -1.1524
3 A A -1.1021
4 N A -1.5736
5 S A -1.2886
6 G A -1.3906
7 S A -1.3747
8 L A 0.0000
9 E A -1.9458
10 V A -0.7937
11 V A 0.2505
12 E A -1.3246
13 A A -1.1419
14 S A -1.4619
15 P A -1.7756
16 T A -1.1635
17 S A -1.1345
18 L A 0.0000
19 Q A -0.8209
20 V A 0.0000
21 S A -1.1179
22 W A 0.0000
23 D A -2.3927
24 A A -1.3196
25 F A 0.0000
26 H A -1.0451
27 R A -0.5809
28 Y A -0.0246
29 H A -0.0271
30 N A -0.8525
31 G A -0.1064
32 F A 1.2503
33 T A 0.4845
34 H A -0.0271
35 P A -0.5171
36 V A -1.0532
37 R A -1.5194
38 Y A -0.9319
39 Y A 0.0000
40 R A -0.8861
41 V A 0.0000
42 T A 0.0000
43 Y A -0.4552
44 G A -0.7349
45 E A -1.5706
46 T A -1.2105
47 G A -1.2255
48 G A -1.3835
49 N A -1.5484
50 S A -0.9287
51 P A -0.4214
52 V A 0.2782
53 Q A -1.2198
54 E A -1.8104
55 F A -0.7097
56 T A -0.2776
57 V A 0.0000
58 P A -1.0148
59 G A -1.2531
60 S A -1.1802
61 K A -1.6322
62 S A -1.2204
63 T A -0.8302
64 A A 0.0000
65 T A -0.3458
66 V A 0.0000
67 S A -0.7525
68 G A -0.9797
69 L A 0.0000
70 K A -2.4145
71 P A -1.9428
72 G A -1.1974
73 V A -1.1851
74 D A -2.0869
75 Y A 0.0000
76 T A -0.7923
77 C A 0.0000
78 T A -0.5428
79 V A 0.0000
80 Y A -0.3291
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.4342
85 Y A 0.0000
86 P A -0.4813
87 R A -1.1304
88 Y A 0.6534
89 G A 0.7827
90 Y A 1.1165
91 G A 0.3564
92 E A -0.5172
93 S A 0.0000
94 G A -0.7473
95 P A -0.4995
96 V A 0.0000
97 S A -0.7165
98 C A -0.9335
99 N A -1.7514
100 Y A -1.4412
101 R A -2.3790
102 T A 0.0000
103 E A -2.0469
104 L A -1.0615
105 D A -2.5941
106 K A -2.7335
107 P A -1.7888
108 S A -1.6454
109 Q A -1.6649
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018