Project name: db6947c8c435bf9

Chain sequence(s)	A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:01)

• Minimal score value: -4.017
• Maximal score value: 3.2329
• Average score: -0.7646
• Total score value: -107.0489

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.1827
2	D	A	-0.0126
3	V	A	1.7219
4	F	A	2.0971
5	M	A	0.9137
6	K	A	-0.9798
7	G	A	-0.4319
8	L	A	-0.0467
9	S	A	-1.3904
10	K	A	-2.5883
11	A	A	-1.5805
12	K	A	-2.2824
13	E	A	-2.3753
14	G	A	-1.1143
15	V	A	0.2861
16	V	A	-0.2006
17	A	A	-1.0490
18	A	A	-1.0588
19	A	A	-1.3939
20	E	A	-2.8531
21	K	A	-2.9899
22	T	A	-2.3289
23	K	A	-3.2197
24	Q	A	-3.1590
25	G	A	-1.9138
26	V	A	-0.4763
27	A	A	-1.4048
28	E	A	-2.4145
29	A	A	-1.4776
30	A	A	-1.1896
31	G	A	-1.9430
32	K	A	-2.9760
33	T	A	-2.2585
34	K	A	-2.2817
35	E	A	-1.6732
36	G	A	0.0664
37	V	A	1.9275
38	L	A	2.4305
39	Y	A	2.3620
40	V	A	2.0008
41	G	A	0.6508
42	S	A	-0.8746
43	K	A	-2.0331
44	T	A	-1.2929
45	K	A	-2.3283
46	E	A	-2.3798
47	G	A	-1.1537
48	V	A	0.8636
49	V	A	1.4739
50	H	A	0.1972
51	G	A	1.2053
52	V	A	2.3657
53	A	A	1.0322
54	T	A	0.4757
55	V	A	0.9769
56	A	A	-0.8281
57	E	A	-2.8161
58	K	A	-3.0024
59	T	A	-2.1036
60	K	A	-3.3572
61	E	A	-3.7035
62	Q	A	-2.7013
63	V	A	-0.5700
64	T	A	-0.9012
65	N	A	-1.0204
66	V	A	1.0127
67	G	A	1.0075
68	G	A	1.0300
69	A	A	1.7623
70	V	A	3.0383
71	V	A	3.2329
72	T	A	2.0923
73	G	A	2.1432
74	V	A	2.9917
75	T	A	1.4662
76	A	A	1.0710
77	V	A	1.5965
78	A	A	0.3987
79	Q	A	-1.1485
80	K	A	-1.6601
81	T	A	-0.5750
82	V	A	0.2441
83	E	A	-1.6663
84	G	A	-0.7717
85	A	A	0.1084
86	G	A	-0.1762
87	S	A	0.2793
88	I	A	1.9087
89	A	A	1.3217
90	A	A	1.0565
91	A	A	1.0421
92	T	A	0.6742
93	G	A	0.9096
94	F	A	1.9909
95	V	A	0.5220
96	K	A	-1.8806
97	K	A	-2.8292
98	D	A	-2.6908
99	Q	A	-2.3273
100	L	A	-0.3933
101	G	A	-1.4223
102	K	A	-3.1897
103	N	A	-3.6194
104	E	A	-4.0170
105	E	A	-3.5441
106	G	A	-2.1333
107	A	A	-1.1497
108	P	A	-1.6047
109	Q	A	-2.3658
110	E	A	-2.1145
111	G	A	-0.4986
112	I	A	1.5525
113	L	A	0.9635
114	E	A	-1.2296
115	D	A	-1.2078
116	M	A	0.3142
117	P	A	0.1053
118	V	A	0.4572
119	D	A	-2.0732
120	P	A	-2.1082
121	D	A	-3.4546
122	N	A	-3.5040
123	E	A	-3.2336
124	A	A	-1.3976
125	Y	A	-0.0505
126	E	A	-1.4780
127	M	A	-0.9198
128	P	A	-1.4532
129	S	A	-1.7627
130	E	A	-2.7165
131	E	A	-2.7189
132	G	A	-1.6636
133	Y	A	-0.4139
134	Q	A	-1.6757
135	D	A	-1.8381
136	Y	A	-0.9245
137	E	A	-2.4311
138	P	A	-1.9873
139	E	A	-2.2844
140	A	A	-1.1372