Project name: F36D

Status: done

Started: 2026-07-02 22:36:33
Settings
Chain sequence(s) A: TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHDWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:22)
Show buried residues

Minimal score value
-3.5839
Maximal score value
0.391
Average score
-1.1677
Total score value
-164.6463

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -0.9715
2 A A -1.5282
3 E A -2.2572
4 V A 0.0000
5 M A 0.0000
6 S A 0.0000
7 H A -0.8009
8 V A 0.0000
9 T A 0.0000
10 A A 0.0000
11 H A -0.4196
12 F A -0.6134
13 G A -1.2708
14 K A -2.3868
15 T A 0.0000
16 L A 0.0000
17 E A -3.5151
18 E A -3.5839
19 C A 0.0000
20 R A 0.0000
21 E A -3.5838
22 E A -3.1655
23 S A 0.0000
24 G A -1.8917
25 L A 0.0000
26 S A -0.5917
27 V A -0.1894
28 D A -1.2634
29 I A -0.6869
30 L A 0.0000
31 D A -2.2135
32 E A -2.0712
33 F A 0.0000
34 K A -1.3327
35 H A -1.8997
36 D A -1.6063
37 W A 0.0000
38 S A -2.1640
39 D A -3.1782
40 D A -3.0484
41 F A -1.8689
42 D A -1.9698
43 V A 0.0000
44 V A 0.3910
45 H A -0.9892
46 R A -2.2386
47 E A -1.7142
48 L A 0.0000
49 G A 0.0000
50 C A -0.8973
51 A A 0.0000
52 I A -0.1679
53 I A -0.2053
54 C A -0.8920
55 M A 0.0000
56 S A 0.0000
57 N A -1.8651
58 K A -1.9446
59 F A -0.8804
60 S A -1.0165
61 L A 0.0000
62 M A -1.6705
63 D A -2.4608
64 D A -2.9811
65 D A -2.9220
66 V A -1.7083
67 R A -1.6128
68 M A 0.0000
69 H A -1.2492
70 H A -1.4030
71 V A -0.0295
72 N A -0.9442
73 M A -1.0780
74 D A -2.0468
75 E A -2.4600
76 Y A -1.2252
77 I A 0.0000
78 K A -2.8042
79 S A -1.6457
80 F A -1.2513
81 P A -1.3826
82 N A -1.9528
83 G A 0.0000
84 Q A -2.1881
85 V A -0.3602
86 L A 0.0000
87 A A 0.0000
88 E A -2.6535
89 K A -1.9410
90 M A 0.0000
91 V A -1.5988
92 K A -2.5138
93 L A 0.0000
94 I A -1.1881
95 H A -2.1509
96 N A -2.3290
97 C A 0.0000
98 E A 0.0000
99 K A -2.8549
100 Q A -2.4736
101 F A -1.4936
102 D A -1.8821
103 T A -1.0576
104 E A -1.1593
105 T A -0.9409
106 D A -1.5456
107 D A -1.7618
108 C A -1.2687
109 T A -1.2541
110 R A 0.0000
111 V A 0.0000
112 V A 0.0000
113 K A -0.8103
114 V A 0.0000
115 A A -0.1700
116 A A -0.6465
117 C A -0.9691
118 F A -1.0647
119 K A 0.0000
120 E A -2.8305
121 D A -2.7648
122 S A 0.0000
123 R A -3.0413
124 K A -3.4572
125 E A -3.0393
126 G A -1.9631
127 I A 0.0000
128 A A -1.8617
129 P A 0.0000
130 E A -2.3437
131 V A -1.1217
132 A A -0.6209
133 M A -0.9079
134 V A 0.0000
135 E A -1.5740
136 A A -0.9019
137 V A 0.0000
138 I A -0.8498
139 E A -2.1129
140 K A -1.8181
141 Y A 0.1593
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018