Project name: obj1 [mutate: EI1C, QM3C, VD5C, GM8C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	QM3C,EI1C,GM8C,VD5C
Energy difference between WT (input) and mutated protein (by FoldX)	4.76438 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:43)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)

• Minimal score value: -3.3327
• Maximal score value: 2.2591
• Average score: -0.5622
• Total score value: -67.4657

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	I	C	2.2591	mutated: EI1C
2	V	C	1.8802
3	M	C	0.8897	mutated: QM3C
4	L	C	0.0000
5	D	C	-1.8677	mutated: VD5C
6	E	C	0.0000
7	S	C	-0.3770
8	M	C	0.4681	mutated: GM8C
9	G	C	0.6959
10	G	C	1.1558
11	L	C	1.4403
12	V	C	-0.0395
13	Q	C	-1.3375
14	P	C	-1.4883
15	G	C	-1.4125
16	G	C	-0.9789
17	S	C	-1.0837
18	L	C	-0.4299
19	R	C	-1.1698
20	L	C	0.0000
21	S	C	-0.4906
22	C	C	0.0000
23	A	C	-0.8863
24	A	C	0.0000
25	S	C	0.5410
26	D	C	0.0000
27	F	C	1.5417
28	T	C	0.2494
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2966
40	A	C	-0.9843
41	P	C	-1.2937
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3948
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5828
53	G	C	-1.2446
54	S	C	-1.2284
55	G	C	-1.0812
56	G	C	-0.7341
57	S	C	-0.3019
58	T	C	0.1993
59	Y	C	0.6078
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6165
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.5854
70	I	C	0.0000
71	S	C	-0.5594
72	R	C	-1.3609
73	D	C	-1.9810
74	N	C	-2.1900
75	S	C	-1.7905
76	K	C	-2.3174
77	N	C	-1.6510
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.3760
81	L	C	0.0000
82	Q	C	-0.9306
83	M	C	0.0000
84	N	C	-1.2279
85	S	C	-1.2299
86	L	C	0.0000
87	R	C	-2.4714
88	A	C	-1.8894
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4217
92	A	C	0.0000
93	I	C	1.0773
94	Y	C	0.0000
95	Y	C	0.2868
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1741
101	D	C	-3.3327
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1843
106	G	C	-1.8967
107	F	C	-0.9572
108	D	C	-0.6667
109	Y	C	0.8144
110	W	C	0.5669
111	G	C	-0.5473
112	Q	C	-1.3624
113	G	C	-0.3983
114	T	C	0.4429
115	L	C	1.9374
116	V	C	0.0000
117	T	C	0.3373
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602