Project name: query_structure

Status: done

Started: 2026-03-16 21:26:18
Settings
Chain sequence(s) A: ECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:38)
Show buried residues

Minimal score value
-2.8488
Maximal score value
2.4944
Average score
-0.6983
Total score value
-23.0442

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9138
2 C A -1.2316
3 K A -1.0845
4 G A -0.1495
5 F A 1.2593
6 G A -0.4241
7 K A -1.5459
8 S A -1.0950
9 C A 0.0000
10 V A 0.0010
11 P A -0.9839
12 G A -1.5654
13 K A -2.6427
14 N A -2.6240
15 E A -2.4549
16 C A 0.0000
17 C A -0.5912
18 S A -0.5367
19 G A 0.1667
20 Y A 0.9597
21 A A 0.0293
22 C A -1.0457
23 N A -1.2558
24 S A -1.8089
25 R A -2.8488
26 D A -2.7183
27 K A -2.5780
28 W A -1.3280
29 C A 0.0000
30 K A 0.0179
31 V A 2.0291
32 L A 2.4944
33 L A 2.4251
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018