Project name: dc496a44840cd6

Chain sequence(s)	A: SKIKGSRHWGFILLKRGEPPPGKPADDAGLVSRHWGFILLKRGEPPPGKPADDAGLVSRHWGFILLKRGEPPPGKPADDAGLVSRHWGFILLKRGEPPPGKPADDAGLVSRHWGFILLKRGEPPPGKPADDAGLVSRHWGFILLKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:16)

• Minimal score value: -3.8889
• Maximal score value: 3.7158
• Average score: -1.0278
• Total score value: -165.4814

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.6657
2	K	A	-1.3085
3	I	A	-0.1509
4	K	A	-1.7930
5	G	A	-1.6269
6	S	A	-1.4753
7	R	A	-1.9155
8	H	A	-1.1817
9	W	A	0.7587
10	G	A	1.4791
11	F	A	3.4259
12	I	A	3.7158
13	L	A	2.8965
14	L	A	1.7054
15	K	A	-1.3913
16	R	A	-2.5257
17	G	A	-2.5034
18	E	A	-2.8589
19	P	A	-2.0814
20	P	A	-1.3799
21	P	A	-1.2558
22	G	A	-1.3504
23	K	A	-2.2951
24	P	A	-1.9896
25	A	A	-1.8804
26	D	A	-3.0155
27	D	A	-2.9387
28	A	A	-2.0466
29	G	A	-1.0941
30	L	A	0.7369
31	V	A	0.8582
32	S	A	1.0109
33	R	A	0.7502
34	H	A	1.1326
35	W	A	1.4396
36	G	A	1.0637
37	F	A	0.6696
38	I	A	0.5239
39	L	A	0.1620
40	L	A	0.1016
41	K	A	-1.6223
42	R	A	-2.0154
43	G	A	-2.1925
44	E	A	-2.7494
45	P	A	-2.6447
46	P	A	-1.6713
47	P	A	-1.3267
48	G	A	-1.5021
49	K	A	-2.7912
50	P	A	-2.2053
51	A	A	-2.3878
52	D	A	-3.2773
53	D	A	-3.6637
54	A	A	-2.9066
55	G	A	-1.9744
56	L	A	-0.6500
57	V	A	-0.3934
58	S	A	0.0000
59	R	A	-0.4894
60	H	A	0.3933
61	W	A	0.7315
62	G	A	0.6713
63	F	A	0.5000
64	I	A	0.3332
65	L	A	0.4593
66	L	A	0.4197
67	K	A	-0.9454
68	R	A	-1.9778
69	G	A	-2.0306
70	E	A	-2.5559
71	P	A	-2.5980
72	P	A	-1.5264
73	P	A	-1.2225
74	G	A	-1.3016
75	K	A	-1.9755
76	P	A	-1.8415
77	A	A	-2.2193
78	D	A	-3.1749
79	D	A	-3.4456
80	A	A	-2.5726
81	G	A	-1.8084
82	L	A	-0.6810
83	V	A	-0.0920
84	S	A	0.0000
85	R	A	-0.3806
86	H	A	0.3597
87	W	A	1.1216
88	G	A	0.5862
89	F	A	0.5234
90	I	A	0.5928
91	L	A	0.1403
92	L	A	-0.0580
93	K	A	-2.0982
94	R	A	-2.7539
95	G	A	-2.2175
96	E	A	-3.1331
97	P	A	-2.6547
98	P	A	-1.6536
99	P	A	-1.2656
100	G	A	-1.3942
101	K	A	-2.8306
102	P	A	-2.3872
103	A	A	-2.4560
104	D	A	-3.3051
105	D	A	-3.8889
106	A	A	-3.1147
107	G	A	-2.0904
108	L	A	-0.7277
109	V	A	0.0824
110	S	A	0.0000
111	R	A	0.3127
112	H	A	0.5127
113	W	A	0.7526
114	G	A	0.3115
115	F	A	0.3010
116	I	A	0.3767
117	L	A	0.5786
118	L	A	0.2163
119	K	A	-1.7408
120	R	A	-2.8275
121	G	A	-2.5586
122	E	A	-3.1904
123	P	A	-2.7077
124	P	A	-1.8808
125	P	A	-1.3125
126	G	A	-1.5052
127	K	A	-2.5994
128	P	A	-2.0101
129	A	A	-2.2292
130	D	A	-2.9911
131	D	A	-2.8805
132	A	A	-1.2788
133	G	A	-0.5905
134	L	A	1.2397
135	V	A	1.4851
136	S	A	0.0544
137	R	A	-1.2916
138	H	A	-1.0438
139	W	A	0.5748
140	G	A	1.0756
141	F	A	2.5131
142	I	A	2.0857
143	L	A	1.4579
144	L	A	0.4967
145	K	A	-2.3496
146	R	A	-3.2741
147	G	A	-2.7226
148	E	A	-2.9846
149	P	A	-2.0826
150	P	A	-1.5249
151	P	A	-1.4083
152	G	A	-1.5669
153	K	A	-2.6819
154	P	A	-2.1248
155	A	A	-1.8750
156	D	A	-3.0280
157	D	A	-2.8113
158	A	A	-0.9096
159	G	A	-0.1086
160	L	A	2.0236
161	V	A	2.4627