Project name: dc598225b2f35b9

Chain sequence(s)	A: ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQLEAAAKSVSGFVLMIKSASVHGPGPGLARIRSHVDAHAPELGPGPGPGQKWVNVDPTKNKSGPGPGTSPLSVDHAHTAHRRGPGPGRSVSGFVLMAAYVPATLQPIMAAYSAWEIAINYGPGPGIEQSRLSSTRCKKRALTDKEFAGRRAQW
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:03)

• Minimal score value: -3.3372
• Maximal score value: 1.4832
• Average score: -0.8353
• Total score value: -170.3963

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	0.3179
2	C	A	0.7899
3	V	A	1.4832
4	N	A	0.0329
5	Q	A	-0.1707
6	C	A	0.0000
7	P	A	-0.8932
8	D	A	-1.9009
9	A	A	-1.3006
10	I	A	-1.6481
11	D	A	-2.8214
12	R	A	-2.4003
13	F	A	0.0000
14	I	A	-0.3583
15	V	A	-0.9928
16	K	A	-1.9723
17	D	A	-2.2710
18	K	A	-2.4732
19	G	A	-1.3828
20	C	A	-0.8984
21	H	A	-1.2294
22	G	A	-0.4392
23	V	A	0.6895
24	E	A	-1.0239
25	K	A	-1.9242
26	K	A	-1.2066
27	Y	A	-0.9376
28	Y	A	-0.5715
29	K	A	0.0000
30	Q	A	-0.9941
31	V	A	0.0000
32	Y	A	-0.0672
33	V	A	0.0000
34	A	A	0.0000
35	C	A	0.0000
36	M	A	-1.1927
37	N	A	-1.9614
38	G	A	-1.7692
39	Q	A	-2.1898
40	H	A	-1.8660
41	L	A	-0.2040
42	Y	A	0.5887
43	C	A	0.0000
44	R	A	-0.0916
45	T	A	-0.4049
46	E	A	0.0000
47	W	A	0.7419
48	G	A	-0.0905
49	G	A	-0.8684
50	P	A	-1.0625
51	C	A	-0.6474
52	Q	A	-1.1942
53	L	A	0.0000
54	E	A	0.0000
55	A	A	-0.7860
56	A	A	0.0000
57	A	A	0.0000
58	K	A	-1.1222
59	S	A	-0.5355
60	V	A	0.0000
61	S	A	-0.5713
62	G	A	-0.7456
63	F	A	0.0507
64	V	A	0.2857
65	L	A	0.0000
66	M	A	0.0301
67	I	A	0.0000
68	K	A	-1.6096
69	S	A	-1.1828
70	A	A	-0.9607
71	S	A	-0.7439
72	V	A	-0.2914
73	H	A	-0.8909
74	G	A	-0.6987
75	P	A	-1.0707
76	G	A	-1.0614
77	P	A	-0.9481
78	G	A	0.0000
79	L	A	0.0000
80	A	A	-0.9478
81	R	A	-1.3507
82	I	A	0.0000
83	R	A	-0.7669
84	S	A	-0.9672
85	H	A	0.0000
86	V	A	0.0000
87	D	A	0.0000
88	A	A	-0.6980
89	H	A	-0.7169
90	A	A	-0.7635
91	P	A	-1.2272
92	E	A	-1.9543
93	L	A	-0.9730
94	G	A	-1.0594
95	P	A	-0.8504
96	G	A	0.0000
97	P	A	-0.8102
98	G	A	-0.8477
99	P	A	-0.7928
100	G	A	-1.0208
101	Q	A	-1.0579
102	K	A	-1.2413
103	W	A	0.3960
104	V	A	0.1741
105	N	A	-0.9233
106	V	A	-1.1520
107	D	A	-2.3513
108	P	A	-2.1567
109	T	A	-2.0865
110	K	A	-2.8727
111	N	A	-2.5488
112	K	A	-2.7960
113	S	A	-1.9179
114	G	A	-1.3731
115	P	A	-1.1509
116	G	A	-1.1564
117	P	A	-0.7584
118	G	A	-0.7837
119	T	A	-0.5170
120	S	A	-0.4102
121	P	A	-0.0700
122	L	A	0.4149
123	S	A	0.1085
124	V	A	0.2243
125	D	A	0.0000
126	H	A	-0.1005
127	A	A	-0.0586
128	H	A	-0.4333
129	T	A	0.0000
130	A	A	-1.0947
131	H	A	-1.6269
132	R	A	-2.6861
133	R	A	-2.6727
134	G	A	-2.0107
135	P	A	0.0000
136	G	A	0.0000
137	P	A	-1.6679
138	G	A	-1.4273
139	R	A	-1.7163
140	S	A	0.0000
141	V	A	0.0000
142	S	A	0.0000
143	G	A	0.0000
144	F	A	0.0000
145	V	A	0.0000
146	L	A	0.0000
147	M	A	0.0000
148	A	A	-0.1042
149	A	A	0.0000
150	Y	A	0.0000
151	V	A	-0.0541
152	P	A	0.2606
153	A	A	-0.4320
154	T	A	-0.0620
155	L	A	-0.1420
156	Q	A	-0.7243
157	P	A	-0.1447
158	I	A	0.0000
159	M	A	0.4522
160	A	A	-0.0633
161	A	A	0.0000
162	Y	A	0.0790
163	S	A	-0.2430
164	A	A	0.0000
165	W	A	0.0000
166	E	A	-1.1439
167	I	A	-0.5874
168	A	A	0.0000
169	I	A	0.0000
170	N	A	-1.1079
171	Y	A	-0.3458
172	G	A	-1.1852
173	P	A	-0.7894
174	G	A	-0.6726
175	P	A	-0.9989
176	G	A	-1.2045
177	I	A	-1.2528
178	E	A	-1.6760
179	Q	A	-1.7192
180	S	A	-1.3843
181	R	A	-1.7137
182	L	A	-1.3270
183	S	A	-1.4225
184	S	A	-1.7004
185	T	A	-2.1920
186	R	A	-3.1110
187	C	A	0.0000
188	K	A	-3.1726
189	K	A	-3.3372
190	R	A	-2.4989
191	A	A	0.0000
192	L	A	-1.7673
193	T	A	-1.7117
194	D	A	0.0000
195	K	A	-2.8568
196	E	A	-3.1183
197	F	A	-2.0588
198	A	A	-2.1635
199	G	A	-2.7479
200	R	A	-3.2260
201	R	A	-2.4639
202	A	A	-1.5093
203	Q	A	-1.6382
204	W	A	-0.5369