Project name: dc8f19f067f13aa

Status: done

Started: 2026-07-13 16:41:34
Settings
Chain sequence(s) A: RQWVSAGRRVRQWVSAGRRVRQWVSAGRRVPENAKEKPRQWVSAGRRVPGIKADSLDIRQWVSAGRRVYKAADMWGPPNDPARQWVSAGRRVELGGTNVPAEPVSSEAQPGDPNAPSPENAKEKPPGIKADSLDIPENAKEKPELGGTNVPAEPGIKADSLDIELGGTNVPAEPVSSEAQPGDPNAPSYKAADMWGPPNDPARQWVSAGRRVYKAADMWGPPNDPAPENAKEKPYKAADMWGPPNDPAPGIKADSLDIYKAADMWGPPNDPAELGGTNVPAEYKAADMWGPPNDPAYKAADMWGPPNDPA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:19)
Show buried residues

Minimal score value
-4.0489
Maximal score value
1.8651
Average score
-1.0238
Total score value
-317.377

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 R A -1.9598
2 Q A -1.0880
3 W A 0.9623
4 V A 1.6804
5 S A 0.5491
6 A A -0.3669
7 G A -1.3789
8 R A -2.7855
9 R A -2.6642
10 V A -0.8181
11 R A -1.7482
12 Q A -0.7000
13 W A 1.1283
14 V A 1.0538
15 S A 0.5355
16 A A -0.2960
17 G A -1.2409
18 R A -2.4925
19 R A -2.5345
20 V A -0.9112
21 R A -1.8015
22 Q A -0.6158
23 W A 1.1093
24 V A 1.2999
25 S A 0.4899
26 A A -0.3334
27 G A -1.3811
28 R A -2.2881
29 R A -2.3496
30 V A -0.4658
31 P A -1.4547
32 E A -2.5801
33 N A -2.7521
34 A A -2.7638
35 K A -3.7223
36 E A -4.0489
37 K A -3.8836
38 P A -2.8534
39 R A -2.7682
40 Q A -1.3706
41 W A 0.8432
42 V A 1.1415
43 S A 0.5292
44 A A -0.2664
45 G A -1.4126
46 R A -2.5499
47 R A -2.2415
48 V A -0.6565
49 P A -0.8822
50 G A -0.7373
51 I A -0.6003
52 K A -1.9294
53 A A -1.5049
54 D A -2.2883
55 S A -1.1477
56 L A -0.3524
57 D A -1.3643
58 I A 0.6855
59 R A -1.2867
60 Q A -0.6292
61 W A 1.3452
62 V A 1.3351
63 S A -0.1554
64 A A -0.3909
65 G A -1.2648
66 R A -1.9165
67 R A -1.5102
68 V A 0.7025
69 Y A 0.3634
70 K A -1.0424
71 A A -0.1720
72 A A -0.5690
73 D A -1.2173
74 M A 0.5143
75 W A 0.8133
76 G A -0.8149
77 P A -1.0923
78 P A -1.4857
79 N A -2.8943
80 D A -3.3710
81 P A -2.2588
82 A A -1.5603
83 R A -2.3872
84 Q A -1.6344
85 W A 0.5887
86 V A 1.2789
87 S A 0.0184
88 A A -1.0692
89 G A -1.4627
90 R A -2.4017
91 R A -2.2525
92 V A -0.3226
93 E A -1.1080
94 L A 0.4638
95 G A -0.3888
96 G A -0.7561
97 T A -0.4553
98 N A -0.5116
99 V A 0.7128
100 P A -0.1934
101 A A -0.4318
102 E A -1.3676
103 P A -0.3710
104 V A 0.8329
105 S A -0.1802
106 S A -0.8956
107 E A -2.0855
108 A A -1.6331
109 Q A -2.1243
110 P A -1.7312
111 G A -1.9698
112 D A -2.7740
113 P A -1.9439
114 N A -2.1758
115 A A -1.4034
116 P A -1.3043
117 S A -1.4701
118 P A -1.7935
119 E A -2.9014
120 N A -2.8914
121 A A -2.8130
122 K A -3.6329
123 E A -3.7175
124 K A -3.2788
125 P A -1.6738
126 P A -1.0359
127 G A -0.3546
128 I A 0.6527
129 K A -1.4170
130 A A -1.0488
131 D A -1.9496
132 S A -0.8431
133 L A 0.6227
134 D A -0.6284
135 I A 0.7098
136 P A -0.7657
137 E A -2.4064
138 N A -2.6450
139 A A -2.6698
140 K A -3.6359
141 E A -3.9323
142 K A -3.5367
143 P A -2.3728
144 E A -2.0185
145 L A 0.0378
146 G A -0.3644
147 G A -0.4813
148 T A -0.6424
149 N A -0.6240
150 V A 0.7811
151 P A -0.1248
152 A A -0.8046
153 E A -1.8818
154 P A -1.1408
155 G A -0.3887
156 I A 0.6960
157 K A -1.3290
158 A A -0.9926
159 D A -1.9335
160 S A -0.7830
161 L A 0.4847
162 D A -0.6369
163 I A 0.9725
164 E A -0.5649
165 L A 0.6339
166 G A -0.1130
167 G A -0.8414
168 T A -0.6022
169 N A -0.5821
170 V A 0.8143
171 P A -0.1147
172 A A -0.4816
173 E A -1.4605
174 P A -0.3639
175 V A 0.9608
176 S A 0.0356
177 S A -0.9509
178 E A -2.0309
179 A A -1.6072
180 Q A -1.9944
181 P A -1.4403
182 G A -1.9476
183 D A -2.7069
184 P A -1.9166
185 N A -2.1016
186 A A -1.0633
187 P A -0.5434
188 S A -0.4095
189 Y A 0.3116
190 K A -1.3243
191 A A -0.7244
192 A A -0.6485
193 D A -1.1244
194 M A 0.5527
195 W A 0.7886
196 G A -0.4303
197 P A -0.8305
198 P A -1.6551
199 N A -2.8788
200 D A -3.4556
201 P A -2.2502
202 A A -1.6067
203 R A -2.3520
204 Q A -1.6348
205 W A 0.7225
206 V A 0.9584
207 S A -0.5243
208 A A -0.5934
209 G A -1.0292
210 R A -1.9471
211 R A -1.8570
212 V A 0.3355
213 Y A 0.5017
214 K A -1.0125
215 A A -0.3490
216 A A -0.6766
217 D A -1.1619
218 M A 0.5702
219 W A 0.9669
220 G A -0.1746
221 P A -0.8071
222 P A -1.6179
223 N A -2.4808
224 D A -2.6796
225 P A -1.9216
226 A A -1.5469
227 P A -1.7636
228 E A -2.7598
229 N A -2.8216
230 A A -2.6534
231 K A -3.5233
232 E A -3.4679
233 K A -2.9933
234 P A -1.5823
235 Y A -0.3601
236 K A -1.5416
237 A A -0.5464
238 A A -0.8945
239 D A -1.3622
240 M A 0.4086
241 W A 0.8177
242 G A -0.5979
243 P A -0.9571
244 P A -1.3743
245 N A -2.4952
246 D A -2.6642
247 P A -1.3512
248 A A -0.6924
249 P A -0.5761
250 G A -0.1430
251 I A 0.5479
252 K A -1.3574
253 A A -1.0623
254 D A -2.0103
255 S A -0.5797
256 L A 0.6286
257 D A -0.4757
258 I A 1.8651
259 Y A 1.0353
260 K A -1.0609
261 A A -0.5357
262 A A -0.2406
263 D A -1.1328
264 M A 0.3964
265 W A 0.8467
266 G A -0.2361
267 P A -0.7331
268 P A -1.4291
269 N A -2.4988
270 D A -2.8480
271 P A -1.6790
272 A A -1.4368
273 E A -1.7691
274 L A -0.0441
275 G A -0.6739
276 G A -0.7132
277 T A -0.5860
278 N A -0.6143
279 V A 0.8228
280 P A -0.1356
281 A A -0.5994
282 E A -1.4887
283 Y A -0.2067
284 K A -1.8042
285 A A -0.8803
286 A A -0.6701
287 D A -1.2628
288 M A 0.4693
289 W A 0.8003
290 G A -0.4419
291 P A -0.7337
292 P A -1.4410
293 N A -2.4328
294 D A -2.5510
295 P A -1.5509
296 A A -0.7182
297 Y A -0.4927
298 K A -1.7373
299 A A -0.4341
300 A A -0.3725
301 D A -1.1914
302 M A 0.3752
303 W A 0.8887
304 G A -0.3498
305 P A -0.4354
306 P A -1.4316
307 N A -2.4445
308 D A -2.6044
309 P A -1.5407
310 A A -0.5660
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018