Project name: Mb5-11_LVLFLF

Status: done

Started: 2026-07-06 06:35:12
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTFTVYAVTWYPRYGYGESGPLSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.6377
Maximal score value
1.4936
Average score
-0.6834
Total score value
-74.4952

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4063
2 Q A -0.8970
3 A A -0.9560
4 N A -1.6237
5 S A -1.1266
6 G A 0.0000
7 S A -1.1803
8 L A 0.0000
9 E A -1.7900
10 V A -0.6530
11 V A 0.0841
12 E A -1.4636
13 A A -0.9663
14 S A -1.1624
15 P A -1.3512
16 T A -0.9788
17 S A -1.0669
18 L A 0.0000
19 Q A -1.0736
20 L A 0.0000
21 S A -1.1423
22 W A 0.0000
23 D A -2.2422
24 A A -1.4941
25 F A 0.0000
26 H A -1.0853
27 R A 0.0000
28 Y A 0.9563
29 H A 0.2210
30 N A -0.6047
31 G A 0.1147
32 F A 1.4936
33 T A 0.7601
34 H A 0.0472
35 P A -0.4412
36 V A -1.0476
37 R A -1.5903
38 Y A -0.8943
39 Y A 0.0000
40 R A -0.8063
41 V A 0.0000
42 T A -0.6370
43 Y A -0.3189
44 G A -0.8242
45 E A -1.6376
46 T A -1.3939
47 G A -1.3398
48 G A -1.4152
49 N A -1.5381
50 S A -0.9473
51 P A -0.4256
52 V A 0.2833
53 Q A -1.2096
54 E A -1.7947
55 F A -0.6776
56 T A -0.1652
57 V A -0.4535
58 P A -0.9921
59 G A -1.3087
60 S A -1.3434
61 K A -2.0953
62 S A -1.2812
63 T A -0.9342
64 A A 0.0000
65 T A -0.4208
66 L A 0.0000
67 S A -0.7721
68 G A -0.9456
69 L A 0.0000
70 K A -2.1056
71 P A -1.6463
72 G A -0.9483
73 V A -1.1654
74 D A -2.6094
75 Y A 0.0000
76 T A -0.6870
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2502
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5233
85 Y A 0.0000
86 P A -0.4583
87 R A -1.1062
88 Y A 0.7121
89 G A 0.7211
90 Y A 1.1358
91 G A 0.3754
92 E A -0.5556
93 S A 0.0000
94 G A -0.6827
95 P A -0.3407
96 L A -0.0660
97 S A -0.2237
98 F A -0.0285
99 N A -1.5000
100 Y A -1.3008
101 R A -2.0414
102 T A 0.0000
103 E A -1.3341
104 L A -0.6133
105 D A -2.4256
106 K A -2.6377
107 P A -1.7853
108 S A -1.6454
109 Q A -1.6627
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018