Project name: dcb74267b8b2759

Chain sequence(s)	A: DEEEKKKLLERIKKYVDEKGPPEGVDREKYIEELFKELMKQKEIYDHIEEHGGQKSVG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:24)

• Minimal score value: -5.2846
• Maximal score value: 0.8565
• Average score: -2.6652
• Total score value: -154.5826

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-4.2740
2	E	A	-4.9787
3	E	A	-5.1447
4	E	A	-5.2846
5	K	A	-4.7260
6	K	A	-4.9207
7	K	A	-4.1591
8	L	A	0.0000
9	L	A	-3.0750
10	E	A	-3.9962
11	R	A	-3.8474
12	I	A	0.0000
13	K	A	-3.6621
14	K	A	-4.0981
15	Y	A	-2.6695
16	V	A	0.0000
17	D	A	-4.0873
18	E	A	-3.8403
19	K	A	-3.2404
20	G	A	-2.7847
21	P	A	-2.3204
22	P	A	-1.5283
23	E	A	-2.2016
24	G	A	-1.4337
25	V	A	-1.4783
26	D	A	-3.1435
27	R	A	-3.8353
28	E	A	-4.1693
29	K	A	-4.2037
30	Y	A	-3.1852
31	I	A	0.0000
32	E	A	-4.3068
33	E	A	-4.1921
34	L	A	-2.5716
35	F	A	-2.9000
36	K	A	-3.4466
37	E	A	-3.5776
38	L	A	-2.0232
39	M	A	-1.9540
40	K	A	-2.8367
41	Q	A	-1.9645
42	K	A	-2.2047
43	E	A	-2.2332
44	I	A	-0.0758
45	Y	A	-0.3876
46	D	A	-2.8131
47	H	A	-2.0797
48	I	A	-0.7915
49	E	A	-2.9209
50	E	A	-3.3979
51	H	A	-2.7444
52	G	A	-2.6742
53	G	A	-2.3937
54	Q	A	-2.1335
55	K	A	-2.0794
56	S	A	-0.6008
57	V	A	0.8565
58	G	A	0.1525