Project name: dd27a88a445fe6b

Status: done

Started: 2026-04-20 07:23:36
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASGDWRYYNWAWFRQAPGKGRELVASVGPGRATGWTASDPRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAASRSGEVSSPSSFSYWGQGTQVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)
Show buried residues

Minimal score value
-2.74
Maximal score value
0.9802
Average score
-0.7807
Total score value
-93.6879

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.1790
2 V C -1.3681
3 Q C -1.3981
4 L C 0.0000
5 V C 0.5558
6 E C 0.0000
7 S C -0.6478
8 G C -0.9215
9 G C -0.7163
10 G C 0.1705
11 L C 0.9802
12 V C -0.0578
13 Q C -1.3474
14 P C -1.7015
15 G C -1.5129
16 G C -1.1541
17 S C -1.2133
18 L C -1.0739
19 R C -2.1068
20 L C 0.0000
21 S C -0.4663
22 C C 0.0000
23 A C -0.3128
24 A C 0.0000
25 S C -1.1486
26 G C -1.6401
27 D C -1.5301
28 W C -1.1056
29 R C -1.6622
30 Y C -0.1735
31 Y C 0.0000
32 N C -0.9762
33 W C 0.0000
34 A C 0.0000
35 W C 0.0000
36 F C 0.0000
37 R C -1.2616
38 Q C -1.7898
39 A C -1.7390
40 P C -1.1664
41 G C -1.6550
42 K C -2.7400
43 G C -2.3137
44 R C -2.2937
45 E C -2.2415
46 L C -0.7872
47 V C 0.0000
48 A C 0.0000
49 S C 0.0000
50 V C 0.0000
51 G C 0.0000
52 P C -0.8063
53 G C -1.1091
54 R C -2.0009
55 A C -0.9477
56 T C -0.7361
57 G C -0.4206
58 W C 0.5916
59 T C 0.1494
60 A C -0.0781
61 S C -0.5292
62 D C -0.5337
63 P C -0.6564
64 R C -0.8833
65 F C 0.0000
66 T C -0.5911
67 I C 0.0000
68 S C -0.3354
69 R C -1.0654
70 D C -1.4935
71 N C -1.8166
72 A C -1.4092
73 K C -2.3975
74 R C -2.2799
75 M C -1.0016
76 V C 0.0000
77 Y C -0.6289
78 L C 0.0000
79 Q C -1.5138
80 M C 0.0000
81 N C -1.7415
82 S C -1.3352
83 L C 0.0000
84 R C -2.4921
85 A C -1.8423
86 E C -2.2888
87 D C 0.0000
88 T C -0.9023
89 A C 0.0000
90 V C -0.4462
91 Y C 0.0000
92 Y C -0.3065
93 C C 0.0000
94 A C 0.0000
95 A C 0.0000
96 S C 0.0000
97 R C -2.3838
98 S C -1.6951
99 G C -1.7094
100 E C -2.1399
101 V C -0.5167
102 S C -0.5675
103 S C -0.6991
104 P C -0.7967
105 S C -0.5005
106 S C -0.9404
107 F C 0.0000
108 S C -0.4046
109 Y C -0.3242
110 W C 0.0681
111 G C -0.2616
112 Q C -0.9324
113 G C 0.0000
114 T C -0.7265
115 Q C -0.9710
116 V C 0.0000
117 T C -0.3129
118 V C 0.0000
119 S C -0.7673
120 S C -0.5629
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018