Project name: dd2ac99197912bd

Chain sequence(s)	A: NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNVVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)

• Minimal score value: -2.6847
• Maximal score value: 2.0825
• Average score: -0.6299
• Total score value: -69.2872

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.3627
2	F	A	0.0000
3	M	A	0.7662
4	L	A	0.0000
5	T	A	-0.0051
6	Q	A	-0.4862
7	P	A	-0.9269
8	H	A	-1.5725
9	S	A	-1.1714
10	V	A	-0.6013
11	S	A	-0.2940
12	E	A	-0.6208
13	S	A	-0.4865
14	P	A	-1.0092
15	G	A	-1.6523
16	K	A	-2.0186
17	T	A	-1.2101
18	V	A	0.0000
19	T	A	-0.1877
20	I	A	0.0000
21	S	A	-0.1447
22	C	A	0.0000
23	T	A	-0.3910
24	R	A	-0.3266
25	S	A	-0.3853
26	S	A	-0.6617
27	G	A	-0.9242
28	S	A	-0.9137
29	I	A	0.0000
30	A	A	-0.3133
31	S	A	-0.3581
32	N	A	-0.2488
33	Y	A	0.5271
34	V	A	0.0000
35	Q	A	-0.1424
36	W	A	0.0000
37	Y	A	0.0237
38	Q	A	0.0000
39	Q	A	-1.7264
40	R	A	-2.5687
41	P	A	-1.5218
42	G	A	-1.0892
43	S	A	-1.0789
44	S	A	-0.8263
45	P	A	-0.8412
46	T	A	-0.3817
47	T	A	-0.0696
48	V	A	0.0000
49	I	A	0.0000
50	Y	A	-0.7778
51	E	A	-1.2307
52	D	A	-1.1857
53	N	A	-2.0497
54	Q	A	-2.1064
55	R	A	-1.9572
56	P	A	-0.7064
57	S	A	-0.8611
58	G	A	-0.8413
59	V	A	-0.7663
60	P	A	-1.2914
61	D	A	-2.2002
62	R	A	-1.3074
63	F	A	0.0000
64	S	A	-1.3023
65	G	A	-1.0930
66	S	A	-0.9921
67	I	A	-0.5529
68	D	A	-1.5211
69	S	A	-1.1085
70	S	A	-0.8914
71	S	A	-0.9011
72	N	A	-1.0468
73	S	A	-0.8249
74	A	A	0.0000
75	S	A	-0.5381
76	L	A	0.0000
77	T	A	-0.2698
78	I	A	0.0000
79	S	A	-1.2174
80	G	A	-1.2906
81	L	A	0.0000
82	K	A	-2.2165
83	T	A	-1.6312
84	E	A	-2.6847
85	D	A	0.0000
86	E	A	-2.3451
87	A	A	0.0000
88	D	A	-2.0160
89	Y	A	0.0000
90	Y	A	0.1373
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	Y	A	0.3887
95	D	A	-0.8415
96	S	A	-0.8187
97	S	A	-0.6296
98	N	A	-0.7880
99	V	A	1.0679
100	V	A	1.2230
101	F	A	2.0825
102	G	A	0.7672
103	G	A	-0.3561
104	G	A	-0.6993
105	T	A	0.0000
106	K	A	-2.1483
107	L	A	0.0000
108	T	A	-0.5643
109	V	A	-0.3007
110	L	A	1.1197