Project name: dd38dd5084477cd

Chain sequence(s)	A: GIVEQCCKNICSLKQLEKYCNNEDKELCGSHLVDRLPDKCGERGFFYDRHK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:03)

• Minimal score value: -3.8782
• Maximal score value: 2.0621
• Average score: -1.7914
• Total score value: -91.3589

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-1.0041
2	I	A	-1.0738
3	V	A	-1.5849
4	E	A	-2.8652
5	Q	A	-2.1514
6	C	A	0.0000
7	C	A	-2.0220
8	K	A	-2.5540
9	N	A	-1.0622
10	I	A	1.5470
11	C	A	0.0000
12	S	A	0.0000
13	L	A	-2.1975
14	K	A	-3.5638
15	Q	A	-2.6349
16	L	A	0.0000
17	E	A	-2.9014
18	K	A	-2.6102
19	Y	A	-1.3629
20	C	A	-1.3359
21	N	A	-1.9945
22	N	A	-2.9103
23	E	A	-3.4181
24	D	A	-3.3417
25	K	A	-3.5574
26	E	A	-3.3093
27	L	A	0.0000
28	C	A	-1.5492
29	G	A	0.0000
30	S	A	-1.8217
31	H	A	-2.3583
32	L	A	0.0000
33	V	A	-1.7140
34	D	A	-3.3296
35	R	A	-3.6566
36	L	A	0.0000
37	P	A	-2.6755
38	D	A	-3.8782
39	K	A	-3.5486
40	C	A	0.0000
41	G	A	-2.9326
42	E	A	-3.3620
43	R	A	-3.2802
44	G	A	-1.9204
45	F	A	-0.1358
46	F	A	2.0621
47	Y	A	0.6645
48	D	A	-1.2451
49	R	A	-2.9376
50	H	A	-2.9478
51	K	A	-2.8838