Project name: spytag

Status: done

Started: 2026-04-16 16:53:21
Settings
Chain sequence(s) A: DSATHIKFSKRDEDGKELAGATMELRRDSSGKKTIISTWISDGQVKDFYLYPGKYTFVETAAPDGYEEVVATAITFTTVNEEQGQVTVN
C: DSATHIKFSKRDEDGKELAGATMELRDSSGKKTIISTTWISDGQVKDFYLYPGKKYTFVETAAPDDGYEVVATAITFTVNEQGQVTTVNG
B: AHIVMVDAYKPT
D: AHIVMVVDAYKKPT
input PDB
Selected Chain(s) A,C,B,D
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:11)
Show buried residues

Minimal score value
-3.3311
Maximal score value
1.5709
Average score
-0.7034
Total score value
-132.9427

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
22 D A -2.3437
23 S A -1.1006
24 A A 0.1076
25 T A -0.4491
26 H A -0.4038
27 I A 0.0000
28 K A -1.4283
29 F A 0.0000
30 S A 0.0000
31 K A 0.0000
32 R A -1.4695
33 D A 0.0000
34 E A -2.7446
35 D A -3.2175
36 G A -2.4488
37 K A -3.0635
38 E A -2.1700
39 L A -1.5349
40 A A -1.4968
41 G A -0.8112
42 A A 0.0000
43 T A 0.0000
44 M A 0.0000
45 E A 0.0000
46 L A 0.0000
47 R A -1.2375
48 D A -1.5895
49 S A -1.5248
50 S A -1.2983
51 G A -1.6176
52 K A -2.1257
53 T A -0.7252
54 I A 0.2094
55 S A 0.0343
56 T A 0.1471
57 W A 0.0000
58 I A -0.2579
59 S A -1.1863
60 D A -2.5523
61 G A -2.0794
62 Q A -2.2586
63 V A -1.3574
64 K A -1.9953
65 D A -1.7340
66 F A 0.0000
67 Y A 1.0118
68 L A 0.0000
69 Y A 0.4033
70 P A -1.2715
71 G A -1.0198
72 K A -1.5581
73 Y A -0.9734
74 T A -0.4528
75 F A 0.0000
76 V A 0.5141
77 E A 0.0000
78 T A 0.0000
79 A A 0.1749
80 A A -0.1910
81 P A -0.8163
82 D A -2.1040
83 G A -1.5573
84 Y A -1.0519
85 E A -1.1326
86 V A 0.9711
87 A A 0.6767
88 T A 0.3636
89 A A 0.4641
90 I A 0.4607
91 T A -0.2856
92 F A 0.0000
93 T A -0.6935
94 V A 0.0000
95 N A -2.3892
96 E A -3.2036
97 Q A -2.9687
98 G A -2.1611
99 Q A -1.9812
100 V A -0.8030
101 T A -0.1527
102 V A 0.4830
103 N A -0.6877
22 D C -2.0389
23 S C -1.5367
24 A C -0.7126
25 T C -0.6308
26 H C -0.4706
27 I C 0.0000
28 K C -0.9670
29 F C 0.0000
30 S C 0.0000
31 K C 0.0000
32 R C -1.4682
33 D C 0.0000
34 E C -2.7910
35 D C -3.3311
36 G C -2.7193
37 K C -3.1464
38 E C -2.0996
39 L C -1.3813
40 A C -0.6581
41 G C -0.1450
42 A C 0.0000
43 T C 0.8599
44 M C 0.0000
45 E C -0.1162
46 L C 0.0000
47 R C -1.5270
48 D C -1.6128
49 S C -1.4187
50 S C -1.2505
51 G C -1.4527
52 K C -1.8514
53 T C -0.9898
54 I C -0.5714
55 S C 0.0000
56 T C 0.3385
57 W C 0.7818
58 I C 1.5709
59 S C 0.0000
60 D C -1.2140
61 G C -1.3617
62 Q C -1.2188
63 V C -0.2721
64 K C -0.3610
65 D C 0.0000
66 F C 0.0000
67 Y C 0.1431
68 L C 0.0000
69 Y C -0.0860
70 P C -1.0914
71 G C -0.9925
72 K C -1.3905
73 Y C 0.0000
74 T C -0.6180
75 F C 0.0000
76 V C 0.3773
77 E C 0.0000
78 T C 0.5602
79 A C 0.2422
80 A C -0.0758
81 P C -0.7224
82 D C -2.1354
83 G C -1.4192
84 Y C -0.9530
85 E C -1.0235
86 V C 1.1461
87 A C 0.8002
88 T C 0.4368
89 A C 0.4127
90 I C 0.5638
91 T C -0.1408
92 F C 0.0000
93 T C -0.5760
94 V C 0.0000
95 N C -2.1961
96 E C -2.8217
97 Q C -2.6898
98 G C -1.9750
99 Q C -1.9738
100 V C -0.6249
101 T C 0.2156
102 V C 1.2776
103 N C -0.1825
104 G C -0.2693
111 A B -0.8104
112 H B -0.9375
113 I B 0.0000
114 V B 1.0567
115 M B 0.0000
116 V B 0.2257
117 D B 0.0000
118 A B -0.6190
119 Y B -0.7079
120 K B -1.7895
121 P B -1.0252
122 T B -0.4612
111 A D -0.8399
112 H D -0.9781
113 I D 0.0000
114 V D 0.6420
115 M D 0.0000
116 V D 0.2766
117 D D 0.0000
118 A D -0.4675
119 Y D -0.5484
120 K D -1.4831
121 P D -0.8924
122 T D -0.3826
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018