Project name: Mb5-11_LVFFFL

Status: done

Started: 2026-07-06 06:35:22
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPFSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.7756
Maximal score value
1.4458
Average score
-0.7454
Total score value
-81.2522

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3329
2 Q A -1.0143
3 A A -1.1786
4 N A -1.9853
5 S A -1.3396
6 G A -1.5277
7 S A -1.2396
8 L A 0.0000
9 E A -1.7987
10 V A -0.4140
11 V A 0.1236
12 E A -1.3472
13 A A -0.8983
14 S A -1.1329
15 P A -1.6415
16 T A -1.1593
17 S A -1.0701
18 L A 0.0000
19 Q A -0.7212
20 L A 0.0000
21 S A -1.1776
22 W A 0.0000
23 D A -2.6067
24 A A -1.6377
25 F A 0.0000
26 H A -1.2292
27 R A -0.3144
28 Y A 0.8149
29 H A 0.1941
30 N A -0.5913
31 G A 0.1210
32 F A 1.4458
33 T A 0.6409
34 H A -0.0624
35 P A -0.5001
36 V A -1.0681
37 R A -1.5957
38 Y A -0.9221
39 Y A 0.0000
40 R A -0.8374
41 V A 0.0000
42 T A 0.0000
43 Y A -0.3570
44 G A 0.0000
45 E A -1.7715
46 T A -1.4434
47 G A -1.3669
48 G A -1.4401
49 N A -1.5265
50 S A -0.9101
51 P A -0.4019
52 V A 0.3017
53 Q A -1.1917
54 E A -1.7672
55 F A -0.6473
56 T A -0.2215
57 V A 0.0000
58 P A -1.0663
59 G A -1.3315
60 S A -1.3508
61 K A -2.1442
62 S A -1.3841
63 T A -0.9187
64 A A 0.0000
65 T A -0.3376
66 F A 0.0000
67 S A -0.7565
68 G A -1.0057
69 L A 0.0000
70 K A -2.4641
71 P A -1.9760
72 G A -1.2712
73 V A -1.4542
74 D A -2.7648
75 Y A 0.0000
76 T A -0.8613
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2669
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5149
85 Y A 0.0000
86 P A -0.4639
87 R A -1.1068
88 Y A 0.7158
89 G A 0.7349
90 Y A 1.1490
91 G A 0.3720
92 E A -0.5506
93 S A 0.0000
94 G A -0.7780
95 P A -0.4797
96 F A -0.1089
97 S A -0.3345
98 L A -0.6988
99 N A -1.6302
100 Y A -1.3230
101 R A -2.1624
102 T A 0.0000
103 E A -1.9594
104 L A -1.1344
105 D A -2.6871
106 K A -2.7756
107 P A -1.8150
108 S A -1.6347
109 Q A -1.6607
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018