Project name: query_structure

Status: done

Started: 2026-03-16 21:24:33
Settings
Chain sequence(s) A: MIPRGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVLALSFNNYHWHSTNYYIKVRAGDNKYMHLKVFNGPKLRHDKLTHADRVLTGYQVDKNKDDELTGF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-4.0243
Maximal score value
1.7493
Average score
-1.2298
Total score value
-137.7335

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.6532
2 I A 1.7493
3 P A 0.2330
4 R A -1.1877
5 G A -1.1371
6 L A -0.9149
7 S A -1.2764
8 E A -2.1993
9 A A -1.8080
10 K A -1.6300
11 P A -1.0166
12 A A -0.9854
13 T A -1.2894
14 P A -1.7647
15 E A -2.8130
16 I A 0.0000
17 Q A -2.6657
18 E A -3.6181
19 I A 0.0000
20 V A 0.0000
21 D A -3.5724
22 K A -3.2698
23 V A 0.0000
24 K A -2.4292
25 P A -2.1840
26 Q A -2.0533
27 L A 0.0000
28 E A -2.9913
29 E A -3.6487
30 K A -3.1056
31 T A -2.4915
32 N A -3.3686
33 E A -3.2389
34 T A -1.9692
35 Y A 0.0000
36 G A -1.7867
37 K A -2.5981
38 L A 0.0000
39 E A -2.0374
40 A A -1.5597
41 V A -0.6736
42 Q A -1.5582
43 Y A 0.0000
44 K A -1.0379
45 T A -0.5812
46 Q A -0.4520
47 V A 0.1496
48 L A 0.1139
49 A A 0.0878
50 L A 0.9155
51 S A 0.1983
52 F A 0.6940
53 N A -1.0317
54 N A -1.1392
55 Y A 0.2269
56 H A -0.5655
57 W A 0.0325
58 H A -0.6149
59 S A 0.0000
60 T A 0.0000
61 N A -0.0379
62 Y A -0.0289
63 Y A 0.0000
64 I A 0.0000
65 K A 0.0000
66 V A 0.0000
67 R A -2.6822
68 A A -2.1815
69 G A -2.4501
70 D A -2.8547
71 N A -3.4888
72 K A -3.1387
73 Y A 0.0000
74 M A 0.0000
75 H A 0.0000
76 L A 0.0000
77 K A -0.0851
78 V A 0.0000
79 F A -0.3934
80 N A -1.2306
81 G A -1.0504
82 P A -1.1904
83 K A -1.3264
84 L A -0.8709
85 R A -2.7161
86 H A -2.8718
87 D A -3.1378
88 K A -2.8987
89 L A -1.0590
90 T A -1.4810
91 H A -1.6824
92 A A -1.5732
93 D A -2.5857
94 R A -1.6606
95 V A -0.5564
96 L A 0.0000
97 T A -0.0010
98 G A 0.0796
99 Y A 0.2404
100 Q A -0.3571
101 V A -0.6905
102 D A -2.3973
103 K A -3.1491
104 N A -3.7839
105 K A -4.0243
106 D A -3.7052
107 D A -3.4638
108 E A -3.1484
109 L A 0.0000
110 T A -0.5857
111 G A -0.1593
112 F A 0.8557
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018