Project name: AAA

Status: done

Started: 2026-02-24 08:22:05
Settings
Chain sequence(s) A: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:39)
Show buried residues

Minimal score value
-3.8858
Maximal score value
2.3218
Average score
-0.5809
Total score value
-65.0663

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A 0.1009
2 L A -0.4796
3 D A -0.9716
4 T A -0.8600
5 N A -0.8669
6 Y A 0.7241
7 C A 0.0000
8 F A 0.4208
9 S A -0.0772
10 S A -0.5318
11 T A -1.1164
12 E A -2.0051
13 K A -2.5178
14 N A -1.2398
15 C A 0.0000
16 C A 0.0000
17 V A 0.0000
18 R A -0.7871
19 Q A -0.9587
20 L A 0.2403
21 Y A 0.1002
22 I A -1.1636
23 D A -2.6176
24 F A 0.0000
25 R A -3.8858
26 K A -3.6416
27 D A -2.7993
28 L A -1.3868
29 G A -2.1143
30 W A -1.4180
31 K A -1.5017
32 W A 0.1118
33 I A 0.0000
34 H A -1.4959
35 E A -1.9025
36 P A -1.8381
37 K A -2.9714
38 G A 0.0000
39 Y A 0.0000
40 H A -0.8131
41 A A 0.0000
42 N A 0.0000
43 F A 0.8950
44 C A 0.0000
45 L A 0.5574
46 G A -0.7142
47 P A -0.4010
48 C A 0.0000
49 P A 0.8474
50 Y A 1.6393
51 I A 2.3218
52 W A 0.9641
53 S A -0.0477
54 L A -0.5112
55 D A -2.1157
56 T A -1.1016
57 Q A -0.8462
58 Y A 0.7266
59 S A 0.0000
60 K A 0.4266
61 V A 1.9114
62 L A 1.4245
63 A A 0.0000
64 L A 0.6724
65 Y A 0.7753
66 N A -0.5478
67 Q A -1.2524
68 H A -1.6082
69 N A -1.6621
70 P A -1.3624
71 G A -1.1304
72 A A -0.8420
73 S A -0.3941
74 A A 0.0660
75 A A 0.3052
76 P A 0.7458
77 C A 0.7680
78 C A 0.0000
79 V A 0.4943
80 P A -0.5539
81 Q A -1.4940
82 A A -1.3215
83 L A -1.1393
84 E A -1.7397
85 P A -1.3604
86 L A 0.0000
87 P A -0.8900
88 I A 0.0000
89 V A -0.1775
90 Y A 0.0000
91 Y A 0.8518
92 V A 0.9554
93 G A -0.6112
94 R A -2.1505
95 K A -2.0880
96 P A -0.6772
97 K A -0.4183
98 V A 0.4664
99 E A -1.1631
100 Q A -1.6804
101 L A -0.9322
102 S A -1.2740
103 N A -1.6959
104 M A -0.8390
105 I A -0.6042
106 V A 0.0000
107 R A -2.3804
108 S A -1.3748
109 C A 0.0000
110 K A -0.9778
111 C A 0.0000
112 S A -0.5371
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018