Project name: SYE

Status: done

Started: 2025-12-01 08:50:11
Settings
Chain sequence(s) A: MNIFEMLRIDEGLRLKIYKDTEGYYTTGIGHLLTKSPSLNVAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKHVYDSLDAVRRAALINMVFQMGETGVAGFTNSLGMLQQERWDEAAVNLAKSRWYNQTPNRARRVIATFGTGHWDAYKNL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:23)
Show buried residues

Minimal score value
-3.4028
Maximal score value
0.6049
Average score
-1.078
Total score value
-176.7997

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.5242
2 N A -0.5396
3 I A -0.0581
4 F A -0.0719
5 E A -0.6838
6 M A 0.0000
7 L A 0.0000
8 R A -0.4560
9 I A 0.5258
10 D A -0.2726
11 E A -0.5853
12 G A -0.3237
13 L A -0.6443
14 R A -1.4078
15 L A -1.1207
16 K A -1.4667
17 I A -0.8547
18 Y A -1.0950
19 K A -2.1123
20 D A -1.8953
21 T A -1.7759
22 E A -2.7295
23 G A -2.1397
24 Y A -1.5265
25 Y A 0.0000
26 T A 0.0000
27 T A 0.0000
28 G A 0.0000
29 I A 0.0000
30 G A -0.5872
31 H A -0.1721
32 L A -0.0026
33 L A 0.0000
34 T A -0.6169
35 K A -1.7577
36 S A -0.8416
37 P A -0.5520
38 S A -0.2406
39 L A 0.2191
40 N A -1.0343
41 V A -0.3063
42 A A 0.0000
43 K A -1.5310
44 S A -1.7425
45 E A -1.5722
46 L A 0.0000
47 D A -2.4233
48 K A -2.6970
49 A A -1.3309
50 I A -1.3648
51 G A -1.7883
52 R A -2.3408
53 N A -2.5100
54 T A 0.0000
55 N A -2.0509
56 G A 0.0000
57 V A -0.6802
58 I A 0.0000
59 T A -1.8043
60 K A -2.8964
61 D A -3.2776
62 E A -2.1361
63 A A 0.0000
64 E A -2.7017
65 K A -3.2542
66 L A 0.0000
67 F A 0.0000
68 N A -2.4285
69 Q A -2.6958
70 D A -1.9343
71 V A 0.0000
72 D A -2.5157
73 A A -1.7364
74 A A 0.0000
75 V A -1.3733
76 R A -2.5394
77 G A 0.0000
78 I A 0.0000
79 L A -1.6785
80 R A -2.4784
81 N A -2.0259
82 A A -1.3020
83 K A -1.6113
84 L A 0.0000
85 K A -2.3101
86 H A -2.2381
87 V A 0.0000
88 Y A -1.7164
89 D A -2.5616
90 S A -2.2037
91 L A 0.0000
92 D A -1.3497
93 A A -0.9070
94 V A -0.5528
95 R A -0.7685
96 R A -0.9412
97 A A 0.0000
98 A A 0.0000
99 L A 0.0000
100 I A 0.0000
101 N A 0.0000
102 M A 0.0000
103 V A 0.0000
104 F A -0.2133
105 Q A -0.2799
106 M A -0.1764
107 G A -0.5380
108 E A -1.4735
109 T A -0.7117
110 G A -0.6139
111 V A 0.0000
112 A A -0.7983
113 G A -0.8046
114 F A -0.4481
115 T A -0.8105
116 N A -1.4403
117 S A 0.0000
118 L A 0.0000
119 G A -1.6369
120 M A -2.1772
121 L A 0.0000
122 Q A -2.5552
123 Q A -2.7472
124 E A -3.4028
125 R A -3.0038
126 W A -2.0936
127 D A -2.2291
128 E A -1.7515
129 A A 0.0000
130 A A -0.6870
131 V A 0.5369
132 N A -0.5986
133 L A 0.0000
134 A A -1.0420
135 K A -1.9207
136 S A -1.9247
137 R A -2.8298
138 W A 0.0000
139 Y A -2.2061
140 N A -2.6959
141 Q A -2.3878
142 T A -1.6874
143 P A -2.0157
144 N A -2.2406
145 R A 0.0000
146 A A 0.0000
147 R A -2.3488
148 R A -1.6974
149 V A 0.0000
150 I A 0.0000
151 A A -1.2788
152 T A 0.0000
153 F A 0.0000
154 G A -1.0991
155 T A -0.9203
156 G A -0.9653
157 H A -1.5878
158 W A -1.6140
159 D A -2.7657
160 A A -1.8053
161 Y A 0.0000
162 K A -2.4587
163 N A -1.6374
164 L A 0.6049
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018