Project name: dfc2f529cf98b77

Status: done

Started: 2026-04-28 06:44:48
Settings
Chain sequence(s) A: MDKDCEMKRTTLDSPLGKLELSGCEQGLHRIIFLGKGTSAADAVEVPAPAAVLGGPEPLIQATAWLNAYFHKPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISESHLAALVGNPAATAAVNTALDGNPVPILIPCHRVVQGDSDVGPYLGGLAVKEWLLAHEGHRLGKPGLG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-3.2557
Maximal score value
1.5414
Average score
-0.7887
Total score value
-143.5395

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.6511
2 D A -2.5851
3 K A -3.2278
4 D A -3.2557
5 C A -2.8682
6 E A -2.9741
7 M A -2.0821
8 K A -2.4363
9 R A -2.6004
10 T A -1.0390
11 T A -1.0395
12 L A 0.0000
13 D A -1.8954
14 S A 0.0000
15 P A -0.7508
16 L A 0.0000
17 G A -1.4250
18 K A -2.0986
19 L A 0.0000
20 E A -1.3075
21 L A 0.0000
22 S A 0.0000
23 G A 0.0000
24 C A 0.0000
25 E A -3.2448
26 Q A -2.4933
27 G A 0.0000
28 L A 0.0000
29 H A 0.0000
30 R A -1.9272
31 I A 0.0000
32 I A -0.0676
33 F A -0.1004
34 L A -0.4056
35 G A -1.2149
36 K A -2.0470
37 G A -1.0621
38 T A -1.3112
39 S A -0.9159
40 A A -0.4445
41 A A -0.6131
42 D A -1.4884
43 A A -0.4056
44 V A 0.4566
45 E A -1.1734
46 V A -0.5206
47 P A -0.4848
48 A A -0.5047
49 P A -0.2827
50 A A 0.2791
51 A A 0.7857
52 V A 0.7782
53 L A 1.5414
54 G A -0.1360
55 G A -1.1475
56 P A -2.3825
57 E A -2.3751
58 P A -1.2712
59 L A 0.0000
60 I A 0.1065
61 Q A -0.1301
62 A A 0.0000
63 T A 0.0000
64 A A 0.2050
65 W A 0.0000
66 L A 0.0000
67 N A -0.9974
68 A A 0.0000
69 Y A 0.0000
70 F A 0.0000
71 H A -1.5444
72 K A -2.5403
73 P A -2.3561
74 E A -2.9387
75 A A -2.4455
76 I A 0.0000
77 E A -2.8146
78 E A -2.5103
79 F A -0.5721
80 P A -0.1007
81 V A 0.8659
82 P A 0.0000
83 A A -0.4136
84 L A -0.3563
85 H A -1.1797
86 H A -1.1379
87 P A -1.1331
88 V A -1.0747
89 F A 0.0000
90 Q A -2.3258
91 Q A -2.7881
92 E A -2.7580
93 S A -1.3974
94 F A -0.3805
95 T A -0.8285
96 R A -1.3161
97 Q A -0.9575
98 V A 0.0000
99 L A 0.0000
100 W A -0.3238
101 K A -0.5407
102 L A 0.0000
103 L A -0.4974
104 K A -1.4070
105 V A -0.2658
106 V A 0.0000
107 K A -1.6744
108 F A -1.0927
109 G A -0.9223
110 E A -1.1815
111 V A 0.1440
112 I A 0.0000
113 S A -0.9700
114 E A -0.8604
115 S A -1.0823
116 H A -1.1008
117 L A 0.0000
118 A A 0.0000
119 A A -0.7459
120 L A -0.1489
121 V A -0.3908
122 G A -0.9401
123 N A -1.4135
124 P A -1.0309
125 A A -0.5951
126 A A -0.5495
127 T A -0.7291
128 A A -0.2585
129 A A -0.4679
130 V A 0.0000
131 N A -1.4868
132 T A -1.1537
133 A A 0.0000
134 L A 0.0000
135 D A -2.0485
136 G A -1.3292
137 N A 0.0000
138 P A 0.0000
139 V A 0.0000
140 P A 0.0000
141 I A 0.0000
142 L A 0.0000
143 I A 0.0000
144 P A 0.0000
145 C A 0.0000
146 H A 0.0000
147 R A 0.0000
148 V A 0.0000
149 V A -0.8794
150 Q A -1.9173
151 G A -2.0758
152 D A -2.4715
153 S A -1.8779
154 D A -1.9374
155 V A -0.8911
156 G A -0.7581
157 P A -0.3985
158 Y A 0.0000
159 L A 0.4380
160 G A 0.2573
161 G A 0.0200
162 L A 0.6520
163 A A -0.1678
164 V A 0.0000
165 K A 0.0000
166 E A -0.7151
167 W A -0.4099
168 L A 0.0000
169 L A 0.0000
170 A A -0.9432
171 H A -0.6663
172 E A 0.0000
173 G A -1.1813
174 H A -1.4959
175 R A -2.3634
176 L A -1.6528
177 G A -1.8801
178 K A -2.0513
179 P A -1.0897
180 G A -0.6008
181 L A 0.7030
182 G A 0.1140
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018