Project name: dfef7d784abca9d

Chain sequence(s)	A: AELAAYRAALAATRAAAAAMMAAIRADLGDSPEVQALEATMAQLDAATQQLVAALDAKEWATARALAAQVRALVAQQRALLDGIVGRLSAAAQAAYAALVAAAAATAAALDALLAAIAAL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)

• Minimal score value: -2.7011
• Maximal score value: 1.6065
• Average score: -0.5812
• Total score value: -69.7474

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.3724
2	E	A	-1.0384
3	L	A	-0.3951
4	A	A	-0.3202
5	A	A	-0.3568
6	Y	A	0.0000
7	R	A	-0.7106
8	A	A	-0.2860
9	A	A	-0.1355
10	L	A	-0.2295
11	A	A	-0.2939
12	A	A	-0.1895
13	T	A	-0.1382
14	R	A	-0.6636
15	A	A	-0.2227
16	A	A	0.0634
17	A	A	0.0000
18	A	A	-0.0928
19	A	A	-0.0242
20	M	A	0.0000
21	M	A	0.0000
22	A	A	-0.2395
23	A	A	-0.3456
24	I	A	0.0000
25	R	A	-1.5799
26	A	A	-0.8296
27	D	A	-1.3785
28	L	A	-1.3522
29	G	A	-1.7190
30	D	A	-2.7011
31	S	A	-1.9445
32	P	A	-1.8108
33	E	A	-2.2322
34	V	A	0.0000
35	Q	A	-2.3588
36	A	A	-1.2858
37	L	A	0.0000
38	E	A	-1.2642
39	A	A	-0.7405
40	T	A	-0.5903
41	M	A	-0.3596
42	A	A	-0.4389
43	Q	A	-0.9355
44	L	A	-0.7910
45	D	A	-1.1601
46	A	A	-1.0494
47	A	A	0.0000
48	T	A	0.0000
49	Q	A	-1.7391
50	Q	A	-1.5683
51	L	A	0.0000
52	V	A	-0.9766
53	A	A	-1.3210
54	A	A	0.0000
55	L	A	0.0000
56	D	A	-1.7540
57	A	A	-1.6776
58	K	A	-2.6175
59	E	A	-2.5514
60	W	A	-1.2886
61	A	A	-0.8176
62	T	A	-1.0136
63	A	A	0.0000
64	R	A	-1.2337
65	A	A	-0.5075
66	L	A	-0.7680
67	A	A	0.0000
68	A	A	-0.7479
69	Q	A	-0.9614
70	V	A	0.0000
71	R	A	-0.9680
72	A	A	-0.6948
73	L	A	-0.5588
74	V	A	-0.2614
75	A	A	-0.8195
76	Q	A	-1.1109
77	Q	A	0.0000
78	R	A	-1.8511
79	A	A	-1.2445
80	L	A	-0.9684
81	L	A	0.0000
82	D	A	-1.5527
83	G	A	-1.4449
84	I	A	0.0000
85	V	A	-0.8861
86	G	A	-1.4781
87	R	A	-2.1429
88	L	A	0.0000
89	S	A	-0.7297
90	A	A	-0.3196
91	A	A	-0.1422
92	A	A	0.0000
93	Q	A	-0.5704
94	A	A	0.0293
95	A	A	0.1721
96	Y	A	0.0797
97	A	A	0.4323
98	A	A	0.4411
99	L	A	0.0000
100	V	A	0.9673
101	A	A	0.6584
102	A	A	0.3992
103	A	A	0.5096
104	A	A	0.4169
105	A	A	0.1216
106	T	A	-0.1104
107	A	A	-0.4790
108	A	A	-0.5056
109	A	A	-0.6933
110	L	A	0.0000
111	D	A	-1.7783
112	A	A	-0.9048
113	L	A	0.0000
114	L	A	-0.6670
115	A	A	-0.2105
116	A	A	0.0979
117	I	A	0.0000
118	A	A	0.5876
119	A	A	0.8828
120	L	A	1.6065